KEGG   Methylotenera mobilis: Mmol_0524Help
Entry
Mmol_0524         CDS       T00942                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mmb  Methylotenera mobilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmol_0524
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mmol_0524
Enzymes [BR:mmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mmol_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
556480..557622
Genome map
AA seq 380 aa AA seqDB search
MKSSEFNSLVLDAKVIVVKVGSSLVTNNGNGLDQVAIAEWAAQIAALVQQGKQVILVSSG
AVAEGMQRLGWKKRPIAVNELQAAAAVGQMGLVQMYERCFSQHQLHTAQVLLTHDDLADR
KRYLNARTTLRTLLDLKVIPIINENDTVVTDEIKFGDNDTLGSLVANLIEADTLVILTDQ
QGLYSADPRKDPNAQFVQHATAGDLALEQMAGGAGSSVGTGGMLTKILAAKRAARSGAHT
VIASGRESNVLVRLSAGEVIGTHLEATQMKIAARKQWLADHLRTTGKLILDAGAVRVLVA
EGKSLLPIGVTAVEGHFERGDVVACVDAGGHEIARGLVNYSASETARVMRKPSQQIESIL
GYVDEAELIHRDNLVLLKQA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtctgaatttaactctctagtgctagatgcaaaagttattgtggtgaaagta
ggctctagcctagtcactaataacggcaatggtcttgatcaagtagcgattgctgagtgg
gcggcgcagattgccgcgctggtgcagcagggtaagcaagttatattggtttctagcggt
gcagtagctgagggtatgcagcggttaggttggaaaaaacgaccgattgcagtcaatgag
ttgcaggctgcggcagcggtggggcagatgggcttggtgcaaatgtatgagcgctgcttt
agtcagcatcagttacacaccgcgcaggttctgctcacgcatgatgacttggctgataga
aagcgttacttgaatgcgcgcactacattacgcactttgttagatttaaaagttattccg
attattaatgagaacgacacggtggtcaccgacgaaataaaattcggtgataacgatact
ttaggttcattagtcgccaatttgattgaggctgataccttggtgatcttaacggatcag
caaggtttgtattcagctgatccacgtaaagaccccaatgcgcaatttgtgcagcatgca
acggcaggtgatctggccttggagcagatggcaggcggagctggtagtagcgtaggtact
ggtggtatgttaaccaagattttggcagcaaaacgtgcggcccgtagtggcgcgcatacg
gtgattgcctctggtcgtgagtccaacgtgttggtgcgtttgagcgcgggcgaggtaatc
ggtacgcatcttgaagccacgcagatgaaaatcgctgcgcgtaaacagtggttggcggac
catttgcgtaccacaggtaaattaatattggatgcaggtgcggtgcgcgtgctggtggct
gaaggtaaaagtctgttgccgataggtgtgactgcggttgaaggtcattttgagcgcggt
gacgtagtggcctgcgtggacgcgggtggtcatgagattgcacgtggcttggtgaattat
tccgcaagtgaaaccgcaagggtaatgcgtaagcctagtcagcagatagagtccatcttg
ggttatgtcgatgaggctgaattgatacaccgtgataacctagtcctattaaaacaggct
taa

DBGET integrated database retrieval system