KEGG   Methylotenera mobilis: Mmol_0593Help
Entry
Mmol_0593         CDS       T00942                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mmb  Methylotenera mobilis
Brite
Enzymes [BR:mmb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Mmol_0593
Secretion system [BR:mmb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Mmol_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
629193..629909
Genome map
AA seq 238 aa AA seqDB search
MLKKFASIALLSAFATAAVADEASVKKAVEAAYPKFKVEKVTKTPYTGLYEVFMGGQIIY
TDEKMSFLIAEGHLVDPKTKKDLTSERLEELTRVDFSSLPLNQAIKVVKGNGSRKLVVFS
DVDCPFCKRLERNELANVTDVTVYTFLFPIEQLHPDAASKSKLIWCAKDRVKAWEDWILR
DQLPSAAGSCEVPLDKVGELARKVGVTSTPTLIFADGKRMLGAQPYKEIERMLSASKK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaagttcgctagtattgctttgctcagcgcgtttgcaacagctgctgtggca
gatgaagccagtgttaaaaaagccgttgaagctgcttaccctaagttcaaggtagagaaa
gtcacaaaaacaccctataccgggctgtatgaagtgttcatgggtgggcagattatttat
accgatgaaaaaatgtcatttttaatcgcagaaggtcatttggttgatccaaaaaccaaa
aaagatcttactagtgagcgcttggaggagctgaccagggttgacttctcctccctacca
ttaaatcaggcgattaaagtagtgaaaggaaatggcagccgtaagttggttgtgttttcc
gatgtggattgccctttctgcaaacggttggagcgtaatgagttagctaatgttacagac
gtcacggtttatactttcttattcccgattgagcagttgcacccagatgcagcgagtaaa
tcaaagctgatctggtgcgcgaaagatcgcgtaaaagcgtgggaagattggattttaaga
gatcaactgcctagtgctgctggcagttgtgaggtacctttagacaaagtgggagagcta
gcaagaaaagttggtgtgactagtacccctaccttaattttcgcagacggcaagcgtatg
ttaggtgcacagccttacaaagagattgagcgcatgctatcggcaagtaaaaaataa

DBGET integrated database retrieval system