KEGG   Methylotenera mobilis: Mmol_0635Help
Entry
Mmol_0635         CDS       T00942                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00240  Pyrimidine metabolism
mmb00250  Alanine, aspartate and glutamate metabolism
mmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mmol_0635
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmol_0635
Enzymes [BR:mmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mmol_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACT47545
JGI: Mmol_0635
UniProt: C6WUE6
Position
complement(671827..672789)
Genome map
AA seq 320 aa AA seqDB search
MNNPQLDTDGQLRHLLSIEGLPKKILNQILDTAESFVGVAEREVKKVPLLRGKTVCNLFF
ENSTRTRTTFEIAAKRLSADVISLNVSTSSQSKGETILDTVDNLIAMHADMFVVRHSQSG
AAHLIAKHVPPHIHVINAGDGRHSHPTQGLLDVFTIRKYKPELHNLRVAIVGDVLHSRVA
RSEIHALTTLGVPEVRVIAPKTLLPAQVEKLGVHVYHDMDEGLKDVDVIMMLRLQNERMN
GAMLPSSEEYFKTYGLTPERLALAKPDAIVMHPGPMNRGVEIDSTVADGKQSVILPQVTY
GIAIRMAVMAILGGGTGAAL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccctcaacttgatactgacggtcaactgcgccatctgctttccatcgaaggc
ttacccaaaaagatacttaaccaaattttagacaccgcagagtcatttgtaggtgtggcc
gaacgcgaagttaaaaaagtaccgttactacgtggtaaaaccgtatgtaatctctttttt
gaaaatagcacccgcacccgcaccacttttgaaatcgcagcaaagcgcctctctgccgat
gtcatcagcctcaatgtcagcacatcgtcacaatctaaaggtgaaaccatcttagacacc
gtggataatttaattgccatgcatgccgatatgtttgtggtgcgccactcacaatcaggc
gctgcgcatttaattgccaagcatgtgccgccgcatattcatgtgattaatgcaggggat
ggccgtcactcacacccaacacaaggcttgttagatgtattcaccatccgtaaatacaag
ccagaactgcacaacttaagagtagctatcgttggtgatgttttacactcacgtgtagcc
cgctctgagattcatgcactcaccacactaggcgtaccagaagtacgcgtgattgcacct
aaaacgctgctaccggcacaagtagaaaaactaggcgtgcatgtctaccacgatatggat
gaaggcttgaaagatgtggatgtcatcatgatgctgcgcctgcaaaatgagcgcatgaac
ggcgcgatgctcccaagctcagaagagtattttaaaacctacggactaacccctgaacga
ctggcgcttgccaaaccagatgccattgtgatgcacccaggcccaatgaaccgcggggta
gagatcgactctaccgttgccgatggcaaacagtcagttatattgccgcaagtcacctac
ggcattgccatccgtatggcagtcatggcaattcttggcggcggtacaggagcagcacta
tga

DBGET integrated database retrieval system