KEGG   Methylotenera mobilis: Mmol_0654Help
Entry
Mmol_0654         CDS       T00942                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00010  Glycolysis / Gluconeogenesis
mmb00020  Citrate cycle (TCA cycle)
mmb00620  Pyruvate metabolism
mmb01100  Metabolic pathways
mmb01110  Biosynthesis of secondary metabolites
mmb01120  Microbial metabolism in diverse environments
mmb01130  Biosynthesis of antibiotics
mmb01200  Carbon metabolism
Module
mmb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmol_0654
   00020 Citrate cycle (TCA cycle)
    Mmol_0654
   00620 Pyruvate metabolism
    Mmol_0654
Enzymes [BR:mmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mmol_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACT47564
JGI: Mmol_0654
UniProt: C6WUG5
Position
700570..701898
Genome map
AA seq 442 aa AA seqDB search
MAVQDIFVPDIGNFDSVDVIEVLVKAGDVIAKDDSLITVESDKASMDIPAPFAGVVQEVK
IKVGDKAAQGTLLITLDVSDAAPAVEVKAAAPAPAVVEAPKAVIPEPTRPAPEPPKPVQP
AQQPVPVAESIVVVSGKLSHASPSIRKFARELGVNLALVKGTGAKNRILQSDVQAYVKGE
LAKPRTENMAAGASGLATLPMPVIDFSKFGAIETKPLSRIKKLSGANLHRNWVTAPHVTQ
FDEADITDLEDFRKSMQADAEKRGVKLTMLAFLIKASVNALKAYPNFNASLSADGDALIL
KNYYNIGFACDTPDGLVVPVVRDVHQKDVLDIARDLMDLSAKARERKLKVEEMQGGCFTI
SSLGGIGGTMFTPIINCPEVAILGVSRSSMQPVYNKDTNSFEPRLILPMSLSYDHRVIDG
ADGARFTSHMRMMLSDVRRLLL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcaagatatttttgtcccggatatcggtaatttcgatagcgtggatgtaatt
gaagtattagttaaggctggcgatgtgattgccaaagatgactccttgattacggtcgag
tctgataaagcttctatggatattcctgcaccttttgctggtgttgtgcaagaagtgaaa
atcaaagttggagacaaggcagcgcaaggcacactgctcatcacattagatgtgagcgat
gcagccccagcggtggaagtaaaagctgcagcgccagcgcctgccgtggtggaagcacca
aaagcggtgattcctgagccaacacgcccagccccagagccaccaaaaccagtacagcca
gcgcaacagccagttcctgtggctgaaagcatcgtggttgtatctggcaagctgtcacat
gcaagcccatcaatccgtaaatttgcgcgtgaattaggcgtgaatttggcattggtgaag
ggtactggtgctaagaatcgtattttacaaagcgatgtacaggcttatgtgaaaggcgaa
ttagcaaaaccgcgtactgaaaacatggcggctggcgctagtggcttggctacattacct
atgccagtgatcgatttcagcaaattcggtgcgattgagactaaacctttatcacgcatt
aagaagctttcaggtgcaaacttacaccgtaactgggtaactgcaccgcacgtgacgcag
tttgatgaagctgatattactgatttggaagacttccgtaaatccatgcaagctgatgct
gaaaaacgtggcgttaagcttacgatgttagcgtttttaattaaagcttccgtcaatgcg
ctaaaagcttaccctaatttcaacgcttcattgtctgctgatggcgatgcgctgattttg
aaaaactactacaacatcggtttcgcttgcgatacacctgatggcttagtggtgccggta
gtgcgtgatgtgcatcaaaaggacgtgctggatatcgcacgtgacttgatggacttgtct
gctaaagcacgtgagcgcaagttgaaagtagaagaaatgcaaggtggttgcttcactatc
tctagcttgggcggtattggcggtaccatgtttacgcccattattaattgcccagaagtg
gcgattttaggtgtgtcacgttcatctatgcagccggtatataacaaagatactaatagc
tttgaaccacgcttgattttgccgatgtcattgtcatatgaccaccgtgtgattgatggt
gcagatggtgcacgtttcactagccatatgcgcatgatgctaagtgatgtgcgcagactg
ttactgtaa

DBGET integrated database retrieval system