KEGG   Methylotenera mobilis: Mmol_0738Help
Entry
Mmol_0738         CDS       T00942                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mmb  Methylotenera mobilis
Brite
Enzymes [BR:mmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mmol_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 NodS Methyltransf_12 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ACT47648
JGI: Mmol_0738
UniProt: C6WUP9
Position
complement(786727..787446)
Genome map
AA seq 239 aa AA seqDB search
MTSNNGYLANSTGNKIVALIKSQAGIGMTSQRTRDRMLNRLREQGIKDEVVLAAIGSTAR
HIFVDEALSIRAYEDVSLPIGFGQTISQPYIVARMSELLRNGQPLEKVLEIGTGCGYQTA
VLSKLAKEVYSVERIRPLLLKARDHLRKLKCINVKLDHADGNMGLAQVAPFDAIIVTAAA
SHIPQDLLAQLAVGGRLVIPVGTDEQILYLVERVSTNDYRQTQLEPVKFVPLLGGTTSQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaacaatggttatctagctaatagtactggaaataaaatcgtggcattgatc
aaatcacaagctggtatcggcatgacatcgcaacgtacgcgcgatcgcatgcttaatcgc
ctgcgtgagcaaggcattaaagatgaagtcgtgctagctgctattggcagcacagcgcgc
catattttcgtagacgaagcgctctccattcgtgcttatgaagacgtgtctttaccgata
ggatttgggcaaaccatttcacagccttatatcgttgcccgtatgtctgagttgctgcgt
aatggccaacctttggaaaaagtgctagaaattggtactggttgcggttaccaaactgcc
gtactatctaagctggctaaagaggtttactctgtagagcgtattcgtcctttgctatta
aaagcgcgagatcacttacgcaagctcaaatgcatcaacgttaagctagaccacgccgac
ggcaatatgggtttagcgcaggtcgccccttttgacgcgattatcgttaccgctgccgca
agccatattccgcaagatttattagcacagctcgcagttggcggtcgtttagtgataccg
gtcggtaccgatgagcagatcctgtatcttgtagagcgcgtatcgacaaatgactaccgt
caaacacagttagaacctgtaaaattcgttcccttacttggcggcaccacttcacaatga

DBGET integrated database retrieval system