KEGG   Methylotenera mobilis: Mmol_0758Help
Entry
Mmol_0758         CDS       T00942                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mmb  Methylotenera mobilis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmol_0758
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmol_0758
   00650 Butanoate metabolism
    Mmol_0758
  Energy metabolism
   00190 Oxidative phosphorylation
    Mmol_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
808050..808397
Genome map
AA seq 115 aa AA seqDB search
MLIELLTKKYPGMRLWLTQRISAVAMVIYLLLLLLVLAIKQPHDYASWLDFMSPWWWRLL
TLVFFVSLLTHAWLGVRDVFKDYVFNLRLRAVLQVTVDILLIGYLCWVSIILWKI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgttgatagaactactcacaaaaaaatacccaggcatgcgtttatggctaacgcagcgc
atttcagccgtggcgatggtgatttatctgctgctactgctgttggtattggcaattaag
caaccacacgattacgcgtcatggctagattttatgtccccctggtggtggcgtttgttg
accctagtattctttgtcagcttattgacccatgcatggctgggggtgcgcgatgtgttt
aaagattatgtatttaacctaagattgcgcgcagtgctgcaagtgacggtggatatattg
ttgattggttacctgtgctgggtaagcattattttatggaagatttaa

DBGET integrated database retrieval system