KEGG   Methylotenera mobilis: Mmol_0789Help
Entry
Mmol_0789         CDS       T00942                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mmb  Methylotenera mobilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
849217..851022
Genome map
AA seq 601 aa AA seqDB search
MEQKNSPIEAARQTLIQLMQRKLPPTPDHFRSVYDEIMGVKSVDQSAELGKTLEKVLNAA
GKKKPKYLAVAQAIGPLVEKGDWLKVEEQLTKLFPSSATGANVEEANWSNVIRNLLKQLE
VSHKGVTLSRKKEGLSKVLVNFASDSDVLAQKIQALVNSWGLSGTADAVMSSEGTIAADA
PSAAKSAVPAGSMANASQWRDMLLRAFELVIIPNLEAAPELHQKAVNLLGRMQKVSNEQS
LIICAADLKSILLSLEMQRDQQSRIHESLLQLLRLVLASMGSMVQTEDQWLYAQTTVISD
IVSKPVSLNTLYDAESSLKELVYKQAQIKPALTEAKDTLKKMVTTFVDRLVEMTESTSDY
HDKIEAYQQKIATTDNIGELNVLLNNILDDTRSIGLTVQRTRDEFMNSQKQALAAEKRIE
ELTAELDYIGQVAHQDYLTGALNRRGMDEALEREFSRADRHNTTLCVAMLDIDHFKKLND
TLGHVTGDEALTHLAKVLKEVLRTTDVLARYGGEEFIIILPATPQDEAVKVITRVQRELT
KNFFMHNNERVLITFSAGVAERVGDESPEVLIPRADAALYKAKHSGRNRVIGADNLPESL
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaaaactctcctattgaagctgctcgccagaccttaatacaactgatgcaa
cgtaagttgccgccaacgccggatcattttcgtagtgtttacgatgaaatcatgggggtt
aaatcagtagatcaatccgcagagctgggtaaaacgctagaaaaagtactcaatgcggct
ggtaagaaaaagcccaagtatcttgcagtggcacaggcgattggcccactcgtagagaag
ggcgactggcttaaagttgaagagcaattaaccaagttgtttccatcaagcgccacgggt
gccaatgtggaagaggcgaactggtctaacgtgattcgcaatctgctgaaacagctggaa
gtcagtcacaaaggtgtcacgctgagccggaagaaagagggcttaagtaaggtgctggtt
aatttcgccagcgactccgatgtgctcgcacaaaaaattcaggcattggttaactcttgg
gggttaagcggtaccgctgatgcggtgatgtcttcagaaggtacgattgccgctgatgct
ccaagtgcggctaaatcggcagtgcctgcgggttctatggctaatgctagccaatggcgc
gacatgctgttacgcgcatttgaactggtcattatcccaaatctagaggcggcaccggag
ctacaccagaaagctgttaatttgctgggtcgtatgcaaaaggtcagcaatgagcaaagt
ctaattatctgcgccgcagatttaaaatcgattttactctcgctggagatgcagcgagat
cagcaaagccgtatccatgagtcattattgcagctgttgcgcttagtgctggctagcatg
ggttccatggtgcaaactgaagaccagtggctgtatgcacaaaccacggtgatcagtgac
attgtgtctaaacccgtgagcctgaacactctgtatgatgccgaaagtagcctaaaagag
ctggtgtataagcaagcgcagattaaaccggcgctgactgaggcaaaggacaccctgaaa
aaaatggtgacgaccttcgtggataggctggtggaaatgacagaaagtaccagcgactat
cacgacaagatcgaagcgtaccagcaaaaaatcgctactacggataacattggcgagctg
aacgtgttgctgaataacattctggatgacacccgttctattggtttaacggtgcagcgt
acccgggatgagtttatgaacagccaaaagcaagcacttgctgcggagaaacgcattgaa
gaactcactgctgagcttgattatattgggcaagtagcacatcaggattatctaacaggg
gcgttaaatcggcgcggtatggatgaggcattagagcgtgaatttagccgcgctgatcgc
cacaacactacattatgcgtggcaatgctggatattgaccactttaagaagcttaatgac
acccttggtcacgtaacgggtgatgaggccttaacccatctggctaaagtgttgaaagag
gtattgcgcactaccgatgtactggcacgttacggcggcgaagagtttattattatcctg
cctgctaccccgcaggatgaagcggtgaaggtgattacacgggtgcagcgcgaactgact
aaaaacttctttatgcacaataatgagcgcgtgctgattacttttagcgccggcgttgcc
gagcgcgtaggggatgagtccccggaggtgttaattccgcgcgctgatgctgcactttac
aaagcaaagcacagtgggcgtaaccgggtgattggggccgataacttgcctgagagtttg
gtttaa

DBGET integrated database retrieval system