KEGG   Methylotenera mobilis: Mmol_0789Help
Entry
Mmol_0789         CDS       T00942                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mmb  Methylotenera mobilis
Brite
Enzymes [BR:mmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mmol_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
849217..851022
Genome map
AA seq 601 aa AA seqDB search
MEQKNSPIEAARQTLIQLMQRKLPPTPDHFRSVYDEIMGVKSVDQSAELGKTLEKVLNAA
GKKKPKYLAVAQAIGPLVEKGDWLKVEEQLTKLFPSSATGANVEEANWSNVIRNLLKQLE
VSHKGVTLSRKKEGLSKVLVNFASDSDVLAQKIQALVNSWGLSGTADAVMSSEGTIAADA
PSAAKSAVPAGSMANASQWRDMLLRAFELVIIPNLEAAPELHQKAVNLLGRMQKVSNEQS
LIICAADLKSILLSLEMQRDQQSRIHESLLQLLRLVLASMGSMVQTEDQWLYAQTTVISD
IVSKPVSLNTLYDAESSLKELVYKQAQIKPALTEAKDTLKKMVTTFVDRLVEMTESTSDY
HDKIEAYQQKIATTDNIGELNVLLNNILDDTRSIGLTVQRTRDEFMNSQKQALAAEKRIE
ELTAELDYIGQVAHQDYLTGALNRRGMDEALEREFSRADRHNTTLCVAMLDIDHFKKLND
TLGHVTGDEALTHLAKVLKEVLRTTDVLARYGGEEFIIILPATPQDEAVKVITRVQRELT
KNFFMHNNERVLITFSAGVAERVGDESPEVLIPRADAALYKAKHSGRNRVIGADNLPESL
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaaaactctcctattgaagctgctcgccagaccttaatacaactgatgcaa
cgtaagttgccgccaacgccggatcattttcgtagtgtttacgatgaaatcatgggggtt
aaatcagtagatcaatccgcagagctgggtaaaacgctagaaaaagtactcaatgcggct
ggtaagaaaaagcccaagtatcttgcagtggcacaggcgattggcccactcgtagagaag
ggcgactggcttaaagttgaagagcaattaaccaagttgtttccatcaagcgccacgggt
gccaatgtggaagaggcgaactggtctaacgtgattcgcaatctgctgaaacagctggaa
gtcagtcacaaaggtgtcacgctgagccggaagaaagagggcttaagtaaggtgctggtt
aatttcgccagcgactccgatgtgctcgcacaaaaaattcaggcattggttaactcttgg
gggttaagcggtaccgctgatgcggtgatgtcttcagaaggtacgattgccgctgatgct
ccaagtgcggctaaatcggcagtgcctgcgggttctatggctaatgctagccaatggcgc
gacatgctgttacgcgcatttgaactggtcattatcccaaatctagaggcggcaccggag
ctacaccagaaagctgttaatttgctgggtcgtatgcaaaaggtcagcaatgagcaaagt
ctaattatctgcgccgcagatttaaaatcgattttactctcgctggagatgcagcgagat
cagcaaagccgtatccatgagtcattattgcagctgttgcgcttagtgctggctagcatg
ggttccatggtgcaaactgaagaccagtggctgtatgcacaaaccacggtgatcagtgac
attgtgtctaaacccgtgagcctgaacactctgtatgatgccgaaagtagcctaaaagag
ctggtgtataagcaagcgcagattaaaccggcgctgactgaggcaaaggacaccctgaaa
aaaatggtgacgaccttcgtggataggctggtggaaatgacagaaagtaccagcgactat
cacgacaagatcgaagcgtaccagcaaaaaatcgctactacggataacattggcgagctg
aacgtgttgctgaataacattctggatgacacccgttctattggtttaacggtgcagcgt
acccgggatgagtttatgaacagccaaaagcaagcacttgctgcggagaaacgcattgaa
gaactcactgctgagcttgattatattgggcaagtagcacatcaggattatctaacaggg
gcgttaaatcggcgcggtatggatgaggcattagagcgtgaatttagccgcgctgatcgc
cacaacactacattatgcgtggcaatgctggatattgaccactttaagaagcttaatgac
acccttggtcacgtaacgggtgatgaggccttaacccatctggctaaagtgttgaaagag
gtattgcgcactaccgatgtactggcacgttacggcggcgaagagtttattattatcctg
cctgctaccccgcaggatgaagcggtgaaggtgattacacgggtgcagcgcgaactgact
aaaaacttctttatgcacaataatgagcgcgtgctgattacttttagcgccggcgttgcc
gagcgcgtaggggatgagtccccggaggtgttaattccgcgcgctgatgctgcactttac
aaagcaaagcacagtgggcgtaaccgggtgattggggccgataacttgcctgagagtttg
gtttaa

DBGET integrated database retrieval system