KEGG   Methylotenera mobilis: Mmol_0828Help
Entry
Mmol_0828         CDS       T00942                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmb  Methylotenera mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmol_0828
Enzymes [BR:mmb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mmol_0828
Exosome [BR:mmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmol_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(891848..894085)
Genome map
AA seq 745 aa AA seqDB search
MLKTKSIQTASKAYTHALHRILEARHHDPFSFLGLHSIKIDEQQHYAYRAFLPYATNAKL
KVGKTWVDLEKTHQDGLFEYTSFEHISEVELSAPCLLKITAGTNTYETDDPYTFSSSITQ
DELHLFGEGRLKLAYKTLGAQCITQNNVAGVRFAVWAPNAERVSVIGSFNQWDGRIHSMR
AHGSSGVWDIFIPNLTTSDTYKFEIRNRHTGNILVKTDPYGFEFEHRPGTAAKISTSSHQ
WEDKAWLEARKQRDWLHAPFNCYEVHLGSWQRNDKGHFLSYRELAKTLVPHVASMGYTHV
ELLPISEHPLNESWGYQTTGYFGVTNRFGSPDDLRFLIDAFHQANIGVILDWVPGHFPKD
DWALARFDGTALYEHEDPRLGEHQDWGTYIFNYGRNEVRNFLISNAYFWLQEFHIDGLRV
DAVASMLYLDYSRNPGEWLPNKFGGRENLDVIDFLKQLNVMVGEDFAGVLTIAEESTAWP
MVSRPVYLGGLGFSMKWNMGWMNDTLSYIENDPVHRRYYHDKLTFGQLYAYSENFVLPFS
HDEVVHGKKSLLDKMPGDAWQKFANLRLLTTYQMTTPGKKLNFMGNEFGQGREWNVNASL
DWHLLDDNNAGSKWHKGIQQLHTDLNRLYKQVNALHTLDFEGHGFEWIDCHDTEQSIISY
VRRGLDNSFVIIVLNFTPVLRNEYRIGVPQAGSYAEIFNSDADCYGGSNKGNGTGLHTEN
IPWMHHGQSVVITLPPLAGIVLKIQ
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaaaactaaatcaattcagactgcatccaaagcttacacccacgcgctacaccgc
attctagaagcgcgccatcacgaccctttcagttttttaggactacactccatcaagatt
gatgagcagcaacattatgcttatcgtgcgtttttgccatacgctaccaacgcaaaattg
aaagtaggcaaaacgtgggtggatttagaaaaaacacatcaagatggcctgtttgagtac
accagttttgaacacattagtgaagtcgaattgagcgcaccgtgcctactaaaaattaca
gcaggtacaaacacttacgaaacagacgacccctacacgtttagctctagcatcacgcaa
gatgagctacatctctttggcgaaggccgcttaaaactcgcttacaaaacactgggtgca
caatgcattacgcaaaacaatgttgcaggcgtacgctttgcagtgtgggcacccaatgcg
gaacgcgtgagcgttatcggcagctttaaccaatgggatggacgcattcacagtatgcgc
gcgcacggctccagcggtgtgtgggatattttcatccccaacctgaccaccagcgacact
tataagtttgagatacggaaccgccatactggcaacattctagttaaaaccgacccttat
ggttttgagtttgaacatcgccctggcacagcagcaaaaatcagcaccagcagccatcaa
tgggaagacaaagcatggctagaagcacgcaagcagcgtgattggctacatgcgccattc
aattgctacgaagtgcatttaggttcatggcaacgtaacgataaagggcacttcctcagc
tatcgcgaactggcaaaaacattggtgccacatgtcgcgtcgatgggctacacccacgta
gagctgttgcctatttcagaacatccactgaacgaatcatggggttatcagaccactggc
tattttggtgtcaccaatcgctttggctcacctgatgatttgcgcttcttaatcgatgcg
ttccatcaagccaatattggtgtgatattagactgggtacccggacatttccctaaagat
gattgggcactagcgcgttttgacggtacagcactgtacgaacacgaagaccctcgtctg
ggtgagcatcaggactggggtacctatatcttcaattacggccgcaatgaagtccgcaac
tttttgattagcaacgcttacttctggctgcaagagtttcacattgatggtttacgtgta
gatgcagtagcctctatgctgtacttagactattcacgcaacccaggtgaatggctgccc
aacaaatttggcggtagagaaaacctggatgtgattgatttcttaaaacagctgaacgtt
atggtaggtgaagactttgccggggtgctcacgattgcggaagaatccaccgcatggcct
atggtatcgcgcccagtatatttgggcggactgggtttcagcatgaagtggaacatgggt
tggatgaatgacaccctatcctacattgagaacgacccggtacacagacgttattaccat
gacaagctgaccttcggtcaactttacgcttattcagaaaactttgtgttaccgttttca
catgatgaagtcgtgcacggcaaaaaatcactgttagacaaaatgccaggagacgcatgg
caaaaattcgctaacttgcgcttattgaccacctatcaaatgacaactcccggcaaaaag
ctcaattttatgggtaatgagttcggacaaggccgcgagtggaacgtcaacgctagccta
gactggcacctacttgacgacaacaatgcaggtagcaaatggcataaaggcattcaacaa
ctgcataccgacctcaaccgcctttataaacaggtaaatgcgttacataccctagatttt
gagggacatggatttgaatggatagattgccacgatacagaacaatcaataatcagttac
gtaagacgcggattagacaatagttttgttataatagtgttgaattttacgcccgtgtta
cgtaatgaataccgcattggtgttccacaagccggtagctatgcagaaatattcaatagc
gatgcagactgctacggtggcagtaacaagggtaacggcacagggctgcacacagaaaac
ataccatggatgcatcatggccaatcagtggtcatcacgttgccaccattggctggtata
gttttaaaaatacaataa

DBGET integrated database retrieval system