KEGG   Methylotenera mobilis: Mmol_0831Help
Entry
Mmol_0831         CDS       T00942                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mmb  Methylotenera mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmol_0831
Enzymes [BR:mmb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mmol_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
897447..898949
Genome map
AA seq 500 aa AA seqDB search
MTLQTQASLLNQRQAGVLLHISSLPSAFYTGDLGVESYRFIDFLHEIGAKVWQTLPINMP
HADNSPYQCLSAHAGNPDFISLESLQAQGLLTKQDCAGLITSKLDLLNKAYLNFSQQSEI
QAEYKKLRQAFNRFCKKQASWLDDFALFLALRQHFNQAGWDHWPEPYKNRDKKTIKQVQV
QLAHEIAVVKFTQFVFFSQWLALKAYAAEKNIALFGDIPIFVAYDSADVWAHSDLFKLNS
DKTMSVVAGVPPDYFSETGQRWGNPHYNWEAMQQDGFAWWISRMATQSELFDIVRIDHFR
GLEAAWEIPAVEDTAINGEWVLAPGDALLGAIKQALPEINLVAEDLGIITIEVDALRKKY
HLPGMKILQFAFSGASDNPYLPENIVENSVVYTGTHDNDTTLSWYSTLDDYQRGNVHSRL
AALHGEGHTPNMPNDLIDMALETTALLAIVPMQDILQLNGHHRMNTPGTTSGNWHWRFSW
QQLTAQQKNSIHGTIARTGR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgttacagactcaagcatcacttttaaatcagcgccaagccggtgtgttgttacat
atcagctccctgcccagtgcgttttatacaggtgacctaggcgttgagtcttatcgtttt
attgatttcctacatgaaataggagccaaggtctggcagaccttaccgatcaatatgccg
catgcggataattcgccttatcagtgcttgtctgcccacgctggcaacccggacttcatt
agtttagagtcactgcaggcacaagggctgctgaccaagcaagattgtgccggtttaatt
accagtaaattagacttactcaacaaggcttatcttaattttagccagcaatctgaaatc
caagctgaatataagaagctacgtcaggcttttaaccgcttttgtaaaaagcaggcaagc
tggctagatgactttgccttgtttttggccttgcgccaacatttcaatcaagctggctgg
gatcattggcctgagccttataaaaaccgcgataaaaaaactattaaacaggtgcaggtg
cagctagcacacgaaattgcagtggttaaatttacgcagtttgtgtttttcagccagtgg
cttgcgctgaaagcttacgctgccgaaaaaaatatcgctttatttggcgacatccccatt
tttgttgcttatgacagcgcggatgtgtgggcacattctgacttgttcaagcttaactct
gacaaaactatgagcgtggtggccggcgtgccgcccgattacttctcagaaactgggcag
cgttggggtaatccgcattacaactgggaagcgatgcaacaagatggctttgcatggtgg
atttcgcgcatggcgacgcaaagtgaactgttcgacattgtgcggattgaccactttaga
gggttggaagcagcgtgggagatccccgctgtagaagatactgccattaatggtgagtgg
gtcttggcgcctggtgatgcgctgctgggggcgattaagcaggcactgccagaaattaat
ttagttgctgaagacttaggcattattacgatagaagtcgatgccttgcgtaagaaatac
catctgcccggcatgaagattctgcagtttgcatttagtggcgcaagtgataacccgtat
ttgcctgaaaatattgtagaaaatagtgtggtatacaccggcacccatgataatgatacg
accttgagctggtacagcactctggatgactatcagcgtggtaatgtgcatagccgccta
gcggcattgcatggtgaggggcatacccccaatatgccaaatgacttgattgacatggca
ttagagaccactgcgctattggctatagtgcctatgcaggatatcttgcaattaaatggc
caccaccggatgaatacgcctggcacgactagcggtaactggcactggcgctttagctgg
caacagttgacggcacagcagaagaattctattcacggcactattgcacgtactggacgt
taa

DBGET integrated database retrieval system