KEGG   Methylotenera mobilis: Mmol_0832Help
Entry
Mmol_0832         CDS       T00942                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mmb  Methylotenera mobilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmol_0832
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmol_0832
   00052 Galactose metabolism
    Mmol_0832
   00500 Starch and sucrose metabolism
    Mmol_0832
   00520 Amino sugar and nucleotide sugar metabolism
    Mmol_0832
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mmol_0832
   00524 Butirosin and neomycin biosynthesis
    Mmol_0832
Enzymes [BR:mmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mmol_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
898955..899908
Genome map
AA seq 317 aa AA seqDB search
MPMLIGIDVGGTNLRLGVVEIDAAGLAKPRLLEEMRFQADFSSLCKLHQQAPELAWQQIL
TTTANAIRTVASKYPEVSAVGIGFPGFIAPDNQQILQSPNLPGLRNVDLSKDLSALIGLP
VITENDALAAAYGEYVMYPDRISNLIYVGLGTGVGGGLILNGQPFQGQHGVAMEVGHIIV
QEGGRLCGCGNSGCMEQYASASGVAISYFEATQQRISAAEIASYAAQGDKAAIAAYAQAG
KALAQTLAHILKVIDVTNIVLGGGMSAAWPLISPSFEERLSQDLIPALHGKLKLHISDMG
DQAGIVGAAMLAFRSNN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgctaatcgggattgatgttggcggcactaatctacgtttaggcgtggtggag
attgatgcggcaggcttagctaagccgcgcttgttggaagaaatgcggtttcaggcggat
ttttccagtttatgtaagctgcaccagcaagcgcctgagcttgcatggcagcaaatattg
acaactacggccaacgcaattcgtacggttgccagcaagtacccagaggtaagtgctgtg
ggtattggctttcctgggtttatcgcacctgataaccaacagattttacaatcccccaat
ttgccaggcttgcgcaacgttgacttgagtaaagacttgagtgcattgattggcctgccg
gtaatcactgaaaatgatgcgcttgccgcagcttatggcgaatatgtgatgtatcctgat
cgcattagcaatttaatttacgtgggcttgggcaccggagtaggtggcggtttaatctta
aatggccagccatttcagggccagcacggagttgcgatggaagtggggcatatcattgtg
caagagggcggcaggctttgtggctgcggtaactcgggttgtatggagcagtatgcttca
gctagtggcgtggcaatcagttatttcgaagcaacgcaacaacgcattagcgccgctgaa
atcgccagctatgccgcacagggcgataaagcagcgattgctgcatacgcgcaagcgggc
aaggctttggcgcaaacgttagcacatatacttaaggtgattgatgtaacaaatatcgtg
ttaggcggcgggatgagcgctgcctggccgttgatttctccctcttttgaagagcggttg
tcgcaagacttgattccagccttacatggtaagttaaaactacatatttctgatatgggg
gatcaggctggtattgttggcgcagcaatgttagcatttcgctcgaataattaa

DBGET integrated database retrieval system