KEGG   Methylotenera mobilis: Mmol_0904Help
Entry
Mmol_0904         CDS       T00942                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
mmb  Methylotenera mobilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmol_0904
DNA repair and recombination proteins [BR:mmb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Mmol_0904
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mmol_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(984419..985021)
Genome map
AA seq 200 aa AA seqDB search
MKNPPALEQLIDSLRCLPGVGPKSAQRMAYYLLQRDRQGANGLALALNNALQVVDHCKLC
NTFSEQPICPLCESAQRDKTVLCVVEMPTDLIMLENTRAYSGMYFVLMGRLSPLDGIGPK
EIHLDRLIKRANDGVVTEVILATNYTVEGDATAHYISELLRARGIKVSRIARGMPMGGEI
EYVDTGTLAQAMLERRSVFK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacccgcctgcccttgaacaactgatcgacagcttacgttgtttgccgggcgtg
gggccaaaatcggcgcaacgcatggcttactatttgctgcaacgcgacagacagggtgct
aatggcctagcattagccttgaacaatgcattgcaagtagttgatcattgcaagctgtgc
aacacctttagcgaacagcccatctgcccgctatgcgaatcagcgcagcgagacaaaact
gtgctgtgcgtggttgaaatgccaaccgacctgattatgcttgaaaacacccgtgcttac
agcggtatgtattttgtgttgatgggcagactatctccgctcgatggcattggccctaaa
gaaatccatctggacagactgattaaacgcgctaatgacggcgtggtcactgaggttatc
ttggcaaccaattacacggtagaaggcgatgcaactgcccattacattagtgagttactg
cgtgctcgtggcattaaagtgagccgtatcgcacgcggcatgccgatgggtggggaaatt
gaatacgtagacaccggaacattggcgcaagccatgttagaacgcagaagcgtattcaaa
taa

DBGET integrated database retrieval system