KEGG   Methylotenera mobilis: Mmol_0913Help
Entry
Mmol_0913         CDS       T00942                                 

Definition
Asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmb  Methylotenera mobilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmol_0913
Enzymes [BR:mmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mmol_0913
Peptidases [BR:mmb01002]
 Cysteine Peptidases
  Family C44
   Mmol_0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
999548..1001074
Genome map
AA seq 508 aa AA seqDB search
MCGFLFQVSASTPVNTQLFSQALDSMRWRGPDAQSLVTEQHGKVKVGHCRLSIIDPLARS
DQPMLSNCGRYLIAFNGEIYNHLDLRRELGLQCRTTSDTETILEAYVKIGKQVFPKLDGM
FALVIYDKHTSKWIAARDAFGIKPLFIYKSKESVILSSEASAIAFMTKADVSMQSIEEWR
LIRRPIPGKTFFEGVDELLPGTVIDSDGNATGHWQWAASEHIFNQEQFEDLLTKSVKAHE
LSDVENVSLLSGGLDSALISALSTVEKCYTVGLVQNNEFLGAEDTAQHLQRDLIKVSLSE
DELVAAWQDLTKLRGEPIGLPNEGLIYSVCKAMSPKQKVVLTGEGADELLFGYDGIYRWA
LGSTPLEPASFLSRYGYSSVAATERLLDYVSDLMRNKQSIDFVEDFFYQLHLPGLLRRMD
FASMAASKEARVPFVDKALVAYMYRQSAQIKINDEHSKIPLRLFAKKLGLDGALNRKKIG
FSAQLNQAASRYDDYGSFQKIILESLRW
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggttttttattccaagtttcggcatcaactcctgtcaatacgcagcttttctcg
caagcgcttgattccatgcgctggcgcgggccagatgcgcagagcttggtgactgagcag
catgggaaagtgaaagttgggcattgccgtttatccatcatcgatcccctagctagatcg
gatcagccgatgctgtcaaactgtggccgatatctgatcgcgtttaatggcgaaatctat
aatcacttagatctaaggcgggagcttggtctgcagtgtagaactacctcagacactgaa
accatactggaagcctacgtcaaaattggcaagcaagttttcccaaaactggatggtatg
tttgctctggttatctatgacaaacataccagcaaatggattgccgccagagatgcgttt
ggcatcaagcccttatttatttataagagtaaagagagtgtaattttatcctctgaagct
tctgctattgcgttcatgactaaggctgatgtttctatgcagtctatagaagagtggcgt
ttgattcggcgcccaattcccggtaagaccttttttgagggggtggatgaactactacca
ggtactgtgatagatagtgatggtaatgcaactggccactggcagtgggcagcatctgaa
cacatatttaatcaggagcagttcgaagatttacttactaaatcggtaaaagcgcatgag
ttaagtgatgttgagaatgtatcgttattgagtggaggcttggatagtgccctcatttct
gcgttatcaactgtagaaaagtgttatacagtagggttagtacagaataatgagttttta
ggcgcggaagatactgcgcagcatctgcagcgcgatttaattaaagtaagtttgagtgag
gatgagctggtagcggcttggcaagatttaaccaagcttcgaggtgagccgataggtttg
cctaatgagggcttaatctacagtgtctgtaaggcaatgagcccgaagcaaaaagtggtg
ttaacgggtgagggtgccgatgagttgttgtttggctatgatggtatttaccgatgggcg
ctaggaagtacgccgctggagccagctagctttttgagtcgctatggttattcatcagtg
gcagcaacagagcggttgttagactatgtgagtgacttgatgcgtaataagcaatcgatt
gattttgttgaagactttttctatcagctgcatttgccaggcttgttgcgcagaatggat
tttgcttctatggctgcctcaaaagaggcgcgagtgccgtttgtagataaagcgctggtg
gcttatatgtaccgtcaatctgcgcagattaagattaacgatgagcattcaaaaatcccg
cttaggttgtttgcaaagaaattaggtttggatggagccttgaatagaaaaaaaataggc
ttcagtgcacagttaaatcaagcagcttcaagatatgatgattatggcagttttcaaaaa
ataatattggagtcattaagatggtag

DBGET integrated database retrieval system