KEGG   Methylotenera mobilis: Mmol_0980Help
Entry
Mmol_0980         CDS       T00942                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmb  Methylotenera mobilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmol_0980
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmol_0980
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmol_0980
Enzymes [BR:mmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmol_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1067329..1068531
Genome map
AA seq 400 aa AA seqDB search
MQLYDMPDARGHFGQFGGTFVAETLVEALDELRVMYEKYRHDPEFLAEYAYDLKHFVGRP
SPIYHAKRLSDQVGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKPRVIAETGAGQH
GVATATIAARLGLECVVYMGSEDVKRQAPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNIHNTFYIIGTVAGPHPYPMMVRDFQAVIGIEAKEQMLEMAGRQPDAVVACVGGGS
NAMGIFYPYIDVPNVRLIGVEAAGHGIETGMHAAPLTANSPVGVLHGNRTYLMQDRDGQI
IETHSISAGLDYPGVGPEHAWLKDIKRAEYVAITDDEAMAAFHNLCRTEGIIPALESSHA
LAYGQKLAKTMSKDQIVLVNLSGRGDKDINTVAKLANITL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttatgatatgccagatgcacgtggacattttggacagttcggtggtactttt
gtcgcagaaactttggtggaagcacttgatgagctgcgtgtgatgtatgaaaaataccgt
catgaccctgagttcttggctgagtatgcatatgacttgaaacattttgttggccgtccc
agcccaatttatcatgcaaaacgcttgtctgatcaagttggtggtgcgcaaatttacttg
aagcgcgaagacttaaaccacacgggtgcgcacaaaattaataatacgataggccaagca
ctgttagctaagcgcatgggtaagcctagagtgattgctgaaactggtgctggccagcat
ggcgtggctactgcaaccattgcagcgcgcttgggtttggaatgtgtggtctatatgggt
agcgaagacgtgaaacgtcaggcacctaatgtttatagaatgaaattgttaggcgcgacc
gttgtgccagtcgagagtggttctaaaacgcttaaagacgcactgaatgaagccatgcgt
gactgggtaactaacattcataatactttctacatcatcggtaccgtggctggcccacat
ccatacccaatgatggtgcgtgatttccaagcggtgattggtatagaggctaaagagcaa
atgctggaaatggcagggcgccagcctgatgctgtcgtggcttgtgtaggtggcggctca
aatgcgatgggtatattctacccgtacattgacgtacctaatgtgcgattgattggtgtg
gaagctgcgggtcacggtattgaaaccggcatgcatgcggcgccgcttactgctaacagt
ccagtgggtgtgttacatggcaaccgtacttacctgatgcaagacagagacggtcagatt
attgaaacgcattctatttcagccggtttggattacccaggcgttggccctgagcatgca
tggttgaaagatattaaacgcgcagaatacgtggcgattactgatgatgaagccatggca
gcattccataacctatgccgtactgaaggtattattcctgcattagagtctagccatgca
ctcgcatatgggcaaaaattggctaaaaccatgagcaaagatcagattgtgttggttaac
ctgtctggccgtggtgataaagatattaataccgttgctaagctggcaaatatcacttta
taa

DBGET integrated database retrieval system