KEGG   Methylotenera mobilis: Mmol_0981Help
Entry
Mmol_0981         CDS       T00942                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmb  Methylotenera mobilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmol_0981
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmol_0981
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmol_0981
Enzymes [BR:mmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmol_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1068673..1069473
Genome map
AA seq 266 aa AA seqDB search
MSRIQTTFATLKQQGKTALIPYITAGDPHPKHTVNLMHTLVKNGADMIELGVPFSDPMAD
GPVIQRASERALVHKVGLTSVLDMVKEFRKTDQVTPIVLMGYANPIEAIGATVFADRAKA
ADVDGVITVDYPPEECVGFVQELRARDIDPVFLLSPTTEPKRVELIVNQASGFVYYVSLK
GVTGAANLDIVEVSARVASIRQQTKLPVGVGFGIRDAATAKATAAIADAVVVGSRMVLEI
EASNDDNLLDNVAALMQELKTAVDAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaattcaaacaacttttgctacattaaaacagcaaggcaaaacagccttgatc
ccttacattacggctggagatccacatcctaaacacaccgttaatttaatgcacacattg
gttaaaaacggcgccgatatgattgagttaggtgtgcctttttcagacccgatggctgat
ggcccggtaattcaacgtgcgagcgagcgcgcattggtgcataaagtgggtttaacctca
gtgctggatatggtgaaagagtttcgtaaaaccgatcaggttacaccgattgtgttgatg
ggctacgccaacccgattgaagcaattggtgcgacagtatttgccgacagagctaaggct
gctgatgttgatggtgtgattacggttgattacccacctgaggagtgtgtgggttttgtg
caagagctacgtgcacgtgatattgaccctgtatttttattgtcgccaacaaccgagcct
aagcgtgtggagcttatcgttaatcaggcaagtggttttgtgtattatgtgtcgcttaaa
ggcgttaccggcgccgcgaatctggatatcgtagaggtttctgcacgtgtggcatcgatt
cgtcagcaaactaaactgccggtaggcgtgggttttggtattcgtgatgcagcgacggct
aaggccactgctgcaatcgctgatgcagtggtggtaggtagccgtatggtgctggagatt
gaagcttctaacgatgataatttgttagacaatgttgctgcattgatgcaagagttaaaa
accgcagttgatgctgcgtaa

DBGET integrated database retrieval system