KEGG   Methylotenera mobilis: Mmol_1286Help
Entry
Mmol_1286         CDS       T00942                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mmb  Methylotenera mobilis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mmol_1286
Enzymes [BR:mmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mmol_1286
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mmol_1286
Lipid biosynthesis proteins [BR:mmb01004]
 Fatty acid synthase
  Component type
   Mmol_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1402004..1402648
Genome map
AA seq 214 aa AA seqDB search
MLFRLLLVFKTVLLSLSFLHFVAWSSPVFAENAKIMVYGDSLSAAYGIPQQQGWASLLQK
KLNAERYQYQVINTSISGETTSGGVSRIQQALNQTKPNIVIIELGANDGLRGLPIQDMTA
NLNIMIEQSKKSGAKILLVGMRIPPNYGPQYTKRFSQSYLKLSQEHNVPLVPFMLENIAA
KANLIQDDGLHPNAIAQPLVLDNIWPHLKQLLKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttgttccgtttattgttagtatttaaaaccgtattgcttagtttgtcctttttgcat
ttcgttgcatggtctagcccggtttttgcagaaaacgcaaaaatcatggtgtacggcgat
agcttatctgcggcgtatggcatcccacagcaacaaggctgggcatccttgctacaaaaa
aagttgaatgcggagcgctatcaataccaagtcatcaataccagcattagcggtgaaact
accagtggcggggtcagccgcattcagcaagcacttaaccaaactaaacccaatattgta
attatcgaactaggcgcgaatgacggtctgcgtggtttacctatccaagacatgaccgcc
aacctcaacatcatgattgagcaaagtaaaaaatctggcgccaaaatattattggtgggg
atgagaataccgcccaattacggaccgcaatacacgaagcgatttagccagagctacctc
aagctcagtcaagaacacaatgtaccgctggtaccctttatgctggaaaacatcgccgct
aaagccaatttgattcaggatgatggactacaccccaacgccattgcacagccattagta
ctggataatatttggccacatcttaagcagctacttaaaaagtaa

DBGET integrated database retrieval system