KEGG   Methylotenera mobilis: Mmol_1379Help
Entry
Mmol_1379         CDS       T00942                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00010  Glycolysis / Gluconeogenesis
mmb00620  Pyruvate metabolism
mmb00640  Propanoate metabolism
mmb00680  Methane metabolism
mmb01100  Metabolic pathways
mmb01110  Biosynthesis of secondary metabolites
mmb01120  Microbial metabolism in diverse environments
mmb01130  Biosynthesis of antibiotics
mmb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmol_1379
   00620 Pyruvate metabolism
    Mmol_1379
   00640 Propanoate metabolism
    Mmol_1379
  Energy metabolism
   00680 Methane metabolism
    Mmol_1379
Enzymes [BR:mmb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mmol_1379
Lipid biosynthesis proteins [BR:mmb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mmol_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACT48285
JGI: Mmol_1379
UniProt: C6WWI6
Position
1513905..1515881
Genome map
AA seq 658 aa AA seqDB search
MSIESVLHENRVFEPSAEFVKNANVSGMVAYNQLCAEAAADYEGFWAKLARELLVWNKPF
TKTLNQDNAPFYKWFEDGELNVSANCLDKHLNTIPNKVAIIFEGDDGNTQEVTYKDLYHR
VCQFANGLKKLNLSVGDRVIIYLPMGIEAVVAMQACARIGLIHSVVFGGFSAKSLNERII
DAGAKAVITSDGQFRGGKTLPLKSAVDEGITMGGCDVIEKVVVLKKTGLDIAWNSNNIWW
HDLIADVTDTCEPVMVSAEHPLFLLYTSGSTGKPKGVQHSSAGYLLHAMNTMRWTFDIHE
NDVFWCTADVGWITGHSYVAYGPLAMGATQIIFEGIPTYPNAGRFWQMIEKHKVSIFYTA
PTAIRSLIKASETTPEVAPKNYNLSSLRLLGSVGEPINPEAWMWYFENVGGGRCPIADTF
WQTETGGHVITPLPGVTPLVPGSCTLPFPGIDIDVVDETGKNVPWGTGGLLVIKKPWPSM
IRTIYNDPERYKTSYYPVDLGGKIYLAGDGAIRDAKTGNFTIMGRIDDVLNVSGHRLGTM
EIESALVANHLVAEAAVVGKPHDVKGESVVAYVVLKGPRPEGDEAKKIVAELREWVGKEI
GPIAKPDEIRFGDNLPKTRSGKIMRRLLRTLAKGEEITSDISTLDNPAILEQLKEVVK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcgaatcagttcttcacgaaaaccgtgtatttgagccaagcgcagaatttgtt
aaaaatgcgaatgtctcaggcatggtggcttacaatcagctctgcgcagaagccgccgct
gattatgaaggtttctgggcaaagctcgcacgggaactactggtctggaacaaacctttc
accaaaacccttaatcaagataacgcccctttctacaaatggtttgaagatggcgagctt
aatgtttctgccaactgtttagataaacacttaaacacaattccgaacaaagtcgccatt
atttttgaaggcgatgatggcaacacgcaagaagtcacctataaagatttataccaccgc
gtttgccagtttgcaaacggcttaaaaaagctaaaccttagcgtaggtgaccgcgtcatt
atctacttgccgatgggcattgaagccgtagtcgccatgcaagcctgtgcgcgtatcggc
ttgattcactctgtggtatttggcggcttttcagccaaaagcttaaacgagcggattatt
gatgccggtgcaaaagcagtaatcacctctgacgggcagttccgcggtggcaaaacacta
ccattaaaatcagccgtcgatgaaggcattaccatgggcggctgtgatgtgatcgaaaaa
gtagtagtactaaaaaaaaccggactagacattgcatggaacagcaataacatctggtgg
catgacctgattgcagacgtgactgacacctgcgaaccagtgatggtaagcgcagagcat
ccattatttttactctatacctccggctcaacaggcaagccaaaaggcgtacagcatagc
tcagctggttacttgctccatgccatgaacaccatgcgctggacttttgatattcatgaa
aatgatgtgttctggtgtacagcagatgtgggctggattaccggccactcttacgtagct
tacggcccactggcgatgggtgctacacaaattatttttgaaggcatcccaacctaccct
aatgctggccgcttctggcaaatgatagaaaaacacaaagtctctatcttttacactgcg
ccaaccgcaattcgttcattgattaaagcttctgaaactacaccagaagtagccccaaaa
aattacaacttatccagcttgcgcctgcttggttcagtaggtgaaccaatcaaccctgaa
gcttggatgtggtactttgaaaacgtaggcggcggccgctgcccaattgccgacaccttc
tggcaaacagaaaccggcggccatgtcattacaccgctaccaggcgtcacaccgctagta
ccgggttcatgcaccctgccgttccccggtattgatattgatgtagtagatgaaactggt
aaaaacgtgccttggggcactggtggcttattggtgattaaaaagccatggccatcaatg
attcgcactatttacaacgacccagaacgctacaaaaccagctactacccagtagactta
ggcggtaagatttacctagctggcgatggcgcgatccgcgatgccaaaaccggtaacttc
accatcatgggccgcattgatgacgtgctcaatgtatctggccaccgcttaggcactatg
gaaattgaatctgcattagtggctaaccacttggttgcagaagctgctgtagtaggcaaa
cctcacgatgtaaaaggtgagtctgttgttgcctacgttgtgctaaaaggcccacgccca
gagggtgacgaagcgaaaaaaatcgttgcagaactgcgcgaatgggtaggtaaagaaatt
ggccctatcgccaaaccagatgaaatccgctttggtgacaacctaccaaaaacccgctca
ggaaaaatcatgcgcagactattgcgcacacttgcaaaaggtgaagagattacctcagat
atctcaacactagataacccggctattttggagcaattaaaagaagtcgttaagtaa

DBGET integrated database retrieval system