KEGG   Methylotenera mobilis: Mmol_1554Help
Entry
Mmol_1554         CDS       T00942                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmb  Methylotenera mobilis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1701987..1702655)
Genome map
AA seq 222 aa AA seqDB search
MADELKHAREQLLELSQKLCALGLNRGTSGNASIRVQNAQGQGGLLITPSGMAVEHMRPA
DMVWMDFTGHAQGELAPSSEWRFHVDILRAKPAVNVVVHTHSMFATTLSTLRRDIPAFHY
MIAVAGGDSIKCADYALFGSQQLSDNALHALTNRTACLLANHGMIAVGADAEKALNVTLE
VETLCEQYLRALQVGEPYILTQQEMLEVHEKFKGYGAWANNP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgaactgaagcatgcacgtgagcagttgttggagctgagccaaaagctatgc
gcgttaggcttgaatcgtggcacttccggcaatgctagtattcgtgtgcagaatgcacaa
gggcaaggtggtttgttaatcaccccttcgggtatggcagtggaacatatgcgtcctgcc
gatatggtgtggatggattttaccggccatgcacagggtgaactggcgccatccagtgaa
tggcgctttcatgtggatattttgcgagccaagccggcagtgaatgtagtggtgcacaca
catagcatgtttgcgaccacgctcagcaccttaagacgcgatattccggcttttcattac
atgattgcagtggcgggtggtgatagtatcaagtgtgcggattacgcactgtttggtagt
cagcagttgtcggataacgctttgcacgcattaacaaatagaaccgcctgtttgctggct
aatcacggcatgatcgctgtgggtgcagacgcagaaaaagctttaaacgtcacgctggaa
gtggaaaccttatgcgagcagtatttaagagcgctgcaagtgggtgagccgtatattttg
acgcaacaggaaatgttggaagtacatgaaaagtttaagggctatggcgcatgggccaat
aacccttag

DBGET integrated database retrieval system