KEGG   Methylotenera mobilis: Mmol_1571Help
Entry
Mmol_1571         CDS       T00942                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
mmb  Methylotenera mobilis
Brite
Enzymes [BR:mmb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mmol_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DUF1924
Motif
Other DBs
NCBI-ProteinID: ACT48475
JGI: Mmol_1571
UniProt: C6WX26
Position
complement(1717876..1718898)
Genome map
AA seq 340 aa AA seqDB search
MKMRTRPGTRLMGLLLVMNMAVAGISHAGEIVTKDDFRRPEGIPSPSSNPLTEDKANLGK
TLFFDARLSRDNSMSCATCHAPDKRWSDGRLRPLGSEHVANARRTPTVLNSAWLSALMWD
GRAGSLEAQAVLPITTPHEMNFDMPSVVARLESIQGYRPLFTQAFGDATVNKKRITEALA
SFERTLVSNAAPFDRWVAGDESAISERSKHGFKLFTGKAQCASCHKSWRFTDDSFHDIGL
RTEDIGRGAKVPPQVTLMQYAFKTPSLRDLPINGPYMHDGAMSGLDEVVKHYEKGGIDRK
SRSLEMKPFELTDAERLSLIEFVKTLDGGALKVDYPRMPQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgagaactaggcccggtacacgcttgatgggcctgcttctcgtcatgaatatg
gcggtggcgggtatttcacacgctggcgaaatcgttacaaaagacgattttcgccggccg
gagggaattccgtcaccttcatctaatccgttgacggaagataaagcaaatttaggtaag
acgctgttttttgatgcgcgtctatctcgtgataatagtatgtcttgtgccacctgccat
gcgccagataagcgctggagcgatggtcgtttacgcccgttgggatcagaacatgtagca
aacgcacgccgcacaccaaccgtgctcaatagtgcgtggctttcagccttgatgtgggat
ggccgtgccggctctttagaggcacaagccgtgctgccgattactaccccgcatgaaatg
aattttgatatgcctagcgtagtagcacgcttggaaagcatacaaggataccgtcctttg
tttacacaggcgtttggtgatgctacggtgaacaaaaagcgaattaccgaagcgctagcg
agcttcgagagaacactggtttctaatgcagcgccttttgaccgctgggttgctggtgat
gaaagcgcgattagcgagcgttctaaacatggctttaaattattcacaggcaaggcgcaa
tgtgcctcctgccataagtcgtggcgttttaccgatgatagtttccatgatatcggcctg
cgtactgaagatattggccgcggtgcaaaagtgccgccgcaagtaacgctcatgcagtat
gcgttcaaaacaccatcgttacgtgatctgccgattaatggtccatatatgcacgatggt
gcgatgagtggtttggacgaagtggtcaagcactatgaaaagggtggtattgaccgcaag
agccgttcgctggaaatgaaaccatttgaattgaccgacgcggaaagattatcactgatt
gaatttgttaagacgctggatggcggcgccttgaaggtggattatcctcggatgccacag
taa

DBGET integrated database retrieval system