KEGG   Methylotenera mobilis: Mmol_1571Help
Entry
Mmol_1571         CDS       T00942                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mmb  Methylotenera mobilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1717876..1718898)
Genome map
AA seq 340 aa AA seqDB search
MKMRTRPGTRLMGLLLVMNMAVAGISHAGEIVTKDDFRRPEGIPSPSSNPLTEDKANLGK
TLFFDARLSRDNSMSCATCHAPDKRWSDGRLRPLGSEHVANARRTPTVLNSAWLSALMWD
GRAGSLEAQAVLPITTPHEMNFDMPSVVARLESIQGYRPLFTQAFGDATVNKKRITEALA
SFERTLVSNAAPFDRWVAGDESAISERSKHGFKLFTGKAQCASCHKSWRFTDDSFHDIGL
RTEDIGRGAKVPPQVTLMQYAFKTPSLRDLPINGPYMHDGAMSGLDEVVKHYEKGGIDRK
SRSLEMKPFELTDAERLSLIEFVKTLDGGALKVDYPRMPQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgagaactaggcccggtacacgcttgatgggcctgcttctcgtcatgaatatg
gcggtggcgggtatttcacacgctggcgaaatcgttacaaaagacgattttcgccggccg
gagggaattccgtcaccttcatctaatccgttgacggaagataaagcaaatttaggtaag
acgctgttttttgatgcgcgtctatctcgtgataatagtatgtcttgtgccacctgccat
gcgccagataagcgctggagcgatggtcgtttacgcccgttgggatcagaacatgtagca
aacgcacgccgcacaccaaccgtgctcaatagtgcgtggctttcagccttgatgtgggat
ggccgtgccggctctttagaggcacaagccgtgctgccgattactaccccgcatgaaatg
aattttgatatgcctagcgtagtagcacgcttggaaagcatacaaggataccgtcctttg
tttacacaggcgtttggtgatgctacggtgaacaaaaagcgaattaccgaagcgctagcg
agcttcgagagaacactggtttctaatgcagcgccttttgaccgctgggttgctggtgat
gaaagcgcgattagcgagcgttctaaacatggctttaaattattcacaggcaaggcgcaa
tgtgcctcctgccataagtcgtggcgttttaccgatgatagtttccatgatatcggcctg
cgtactgaagatattggccgcggtgcaaaagtgccgccgcaagtaacgctcatgcagtat
gcgttcaaaacaccatcgttacgtgatctgccgattaatggtccatatatgcacgatggt
gcgatgagtggtttggacgaagtggtcaagcactatgaaaagggtggtattgaccgcaag
agccgttcgctggaaatgaaaccatttgaattgaccgacgcggaaagattatcactgatt
gaatttgttaagacgctggatggcggcgccttgaaggtggattatcctcggatgccacag
taa

DBGET integrated database retrieval system