KEGG   Methylotenera mobilis: Mmol_1608Help
Entry
Mmol_1608         CDS       T00942                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmb  Methylotenera mobilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmol_1608
   01230 Biosynthesis of amino acids
    Mmol_1608
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmol_1608
   00051 Fructose and mannose metabolism
    Mmol_1608
   00562 Inositol phosphate metabolism
    Mmol_1608
Enzymes [BR:mmb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmol_1608
Exosome [BR:mmb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmol_1608
  Exosomal proteins of bladder cancer cells
   Mmol_1608
  Exosomal proteins of melanoma cells
   Mmol_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1753799..1754551)
Genome map
AA seq 250 aa AA seqDB search
MPRKIVVANWKMHGNLATNQQLLQAYLDRLSALKNVEVVVCVPYPYLAQVQSLLQHTAIA
WGAQNLSKDVVGAYTGEVSASMLRDFGATHVIIGHSERATAYCESDENIAAKFMQAKAHG
LVPILCVGETLIEREAGVMEMVVAKQIDTIINLYGAAVFANTVVSYEPIWAIGTGLAATP
DQAQSMHEFIRHRVASHNQEAAASLKILYGGSVNPQNAVQLFNMQDIDGGLIGRCSLSAQ
EFEGICQAAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcctagaaaaatagtagttgccaattggaaaatgcatggcaacttagcaacgaatcaa
cagcttctgcaagcttatcttgatcgattaagcgcactcaaaaatgttgaagtagtcgtc
tgtgtcccatatccatatctcgcgcaggtgcaaagccttttgcagcatactgctatcgca
tggggtgcgcaaaacctcagtaaagatgtagtcggcgcttataccggtgaagtaagtgca
agtatgctgagagactttggcgcaactcacgtcattattggacattcagagcgtgcaaca
gcctattgcgagtctgatgaaaatatcgcagctaagttcatgcaagccaaggcgcatgga
ttagtgccgatactgtgtgtaggtgaaaccttgatcgagcgtgaggccggagtgatggaa
atggtcgtcgccaagcaaattgacaccattattaacctatacggtgcagctgtttttgcg
aatacagtggtttcatacgagccaatctgggcaattggcaccggcttggcagctacgcca
gaccaagcgcagagtatgcatgagtttatccggcatagggttgcaagccacaatcaagaa
gcggcagccagcttgaaaatcctttacggggggagcgtaaatcctcaaaatgcggtacaa
ttattcaatatgcaggatatagatggcggcttgattggtagatgctcattaagcgcgcaa
gaatttgaaggaatttgccaggcggcatgttaa

DBGET integrated database retrieval system