KEGG   Methylotenera mobilis: Mmol_1782Help
Entry
Mmol_1782         CDS       T00942                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmb  Methylotenera mobilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmol_1782
   00052 Galactose metabolism
    Mmol_1782
   00500 Starch and sucrose metabolism
    Mmol_1782
   00520 Amino sugar and nucleotide sugar metabolism
    Mmol_1782
Enzymes [BR:mmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mmol_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1949810..1950712)
Genome map
AA seq 300 aa AA seqDB search
MIKKVTKAVFPVAGLGTRFLPATKANPKEMLPIVDKPLIQYAVEEAIAAGITDLIFITGR
NKRSISDHFDMAYELESELERAGKTALLKVVQSIVPSHVNCIYIRQTQALGLGHAVRLAK
PVVNNEPFAVLLADDLLDGKVSIVKQMVDAYDYYRCSLLGVENVPSDQTKSYGIVATTPL
NERIEQVSAIVEKPDPKDAPSTLAVVGRYILTPRIFHHLDNVQAGKGGEIQLTDAISALL
TEEQVLAYRYEGTRYDCGSKFGYLEANIKLGLRHPEVGAELRALIESLQLEHVATKSKSA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaagtcacaaaagctgtctttcctgttgctggtttgggtacacgctttttg
cctgcgactaaggctaaccctaaagagatgttacccattgttgataagcctttaattcaa
tatgcggtagaggaggcaattgccgccggaattacagatcttattttcattaccggtcgt
aacaagcgctctatatcagaccattttgatatggcttatgagttagaaagcgagctagag
cgtgccggtaagactgcattgctgaaagttgtgcaaagcattgtgcctagccatgttaat
tgtatttatatccgtcaaactcaggcgttgggtttggggcacgcagtacgcttagctaag
cctgtggtaaataatgagccttttgccgtgttgctggcggatgatttgctggatggtaag
gtttccatcgtgaagcaaatggtagacgcttacgactattatcgttgctcactattaggc
gtagaaaatgtaccaagtgatcaaactaaaagctacggtattgttgcgaccacaccactt
aacgaacggattgagcaggtgtccgcgattgttgaaaaaccagatcctaaagatgcgcca
tcgacattagctgtggtcgggcgttatattttaacgcctagaatcttccaccacttagat
aacgtgcaggctggtaaaggtggtgaaatacagttaacggatgctatctcagcattgttg
accgaggagcaggtgctggcttatcgttatgaaggcacgcgctatgattgtggctctaag
tttggttatttagaggcaaatatcaagcttggtttgagacaccctgaagtgggtgccgag
ttacgtgctttgattgagtctcttcaattagaacacgttgctactaaatcgaagagtgca
taa

DBGET integrated database retrieval system