KEGG   Methylotenera mobilis: Mmol_1786Help
Entry
Mmol_1786         CDS       T00942                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmb  Methylotenera mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmol_1786
Enzymes [BR:mmb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mmol_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1955108..1956145)
Genome map
AA seq 345 aa AA seqDB search
MYIDMQKLIRKLICMTLLSLLSCFHTNVNASTECSSAIRGVNLAGAEFAGDKLPAMAGKN
YFFPKIEHLQRANNAGFNAIRLPISWESLQPNLYGALDETYANLLLSFLNQAYLNHQVVI
VDVHNYGRYKKELIGSAQVPSEAFADMWKKLATILHKHPALYAYGLMNEPHHTQGLWHIT
AQFGLNAIREVDTSHLIYVAGDDWSSASSWPKSNPQPFVTDPSDKIVYEAHIYFDDDFSG
RYAKPIGNVNLKARTEARLLPFVSWLKKYKQKGVIGEWGVPTDDPAYDDATETFLSITNT
ECLDWFVWVAGYMRPSYVLSLDSLDGKPKHLLQKLKDRLIKEPAN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtacattgatatgcagaaattaataagaaaactgatttgtatgacattactttctttg
cttagttgttttcatacaaatgttaatgccagtacagaatgttcaagtgctatacgtggg
gtaaatttagctggtgctgagtttgccggagacaagttaccggcaatggcgggtaagaat
tattttttccctaaaattgaacatctgcaacgcgctaataatgctggatttaatgctata
cgcttgccaatatcatgggaaagtttacaacccaatttgtatggtgcgcttgatgagacg
tatgccaacttacttttgtcttttttaaatcaagcttatctcaaccatcaggtcgttatc
gtcgatgtacataattatggacgttacaaaaaagagcttattggtagcgcacaagtccct
tcggaggcttttgctgatatgtggaagaaattggccactatacttcataagcatccagcg
ttatatgcttatggcctaatgaatgagccacaccacactcagggtttgtggcatattacg
gcccaatttggtctaaacgctattcgtgaggttgatacatcacatttaatatatgttgcc
ggtgacgattggagtagtgcgtcatcatggcctaaatctaatccacaaccatttgtcact
gaccctagtgataagattgtttatgaagcccacatttattttgatgatgactttagtggt
cggtatgcaaagcctattggtaacgtaaacttaaaggctaggacagaagccagattattg
ccttttgtttcctggttaaaaaaatataagcaaaagggcgttattggtgagtggggcgta
cctactgatgaccctgcctatgatgatgcaaccgagacctttttatcaatcacaaatacc
gagtgtttagattggtttgtttgggtggctggttatatgagacctagctatgttctgtca
ctcgattcattagatggaaaaccgaagcacttattgcagaaattaaaagacaggctaatt
aaagagcctgctaattaa

DBGET integrated database retrieval system