KEGG   Methylotenera mobilis: Mmol_1884Help
Entry
Mmol_1884         CDS       T00942                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mmb  Methylotenera mobilis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmol_1884
Enzymes [BR:mmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mmol_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2055149..2055655
Genome map
AA seq 168 aa AA seqDB search
MMKRAFVALGSNLENPKAQVERALAALKQLPETRLLKQSSLYQTAPIDCIDTAPDFINAV
AEVETALPPEALLDAILNIENIAGRERPYINAPRVLDCDLLLYEDITLNTSKLTLPHPRM
HLRGFVLLPLFEIAPDISIPNHGKIAAYMTPDLLLGIKKLPSAESYPQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcgcgcatttgttgcattggggagcaacctagagaaccccaaagcgcaggta
gagcgcgcacttgcagcattaaaacagttgccagaaacgcgcttgctcaagcaatcatcg
ctttaccaaacagcaccgattgactgcatagatacagcaccagactttattaacgcggtg
gccgaggtggaaaccgcactcccgcctgaagccttgctagacgcgattctcaacattgaa
aatattgcaggacgcgagcgcccttatatcaatgcgccgcgtgtattggactgtgatttg
ctgttatatgaagatatcacactgaacacgtccaaactgaccttaccgcacccacgcatg
catttgcgtggctttgtattattaccattatttgaaatcgcaccggatatttctatccca
aatcatggcaaaatagctgcatatatgacgccagatttattattaggtatcaaaaaatta
ccctctgcagaaagttaccctcagtaa

DBGET integrated database retrieval system