KEGG   Methylotenera mobilis: Mmol_2175Help
Entry
Mmol_2175         CDS       T00942                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmb01100  Metabolic pathways
mmb01110  Biosynthesis of secondary metabolites
mmb01130  Biosynthesis of antibiotics
mmb01230  Biosynthesis of amino acids
Module
mmb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmol_2175
Enzymes [BR:mmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mmol_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACT49077
JGI: Mmol_2175
UniProt: C6WT15
Position
2351757..2352545
Genome map
AA seq 262 aa AA seqDB search
MSDILNKIIATKTREVAAAKANKSLEMVQQEAATASPTRDFVGSIRAKIANNQAAVIAEI
KKASPSKGVIRADFQPAAIAASYEQGGAACLSVLTDIEYFQGSPEYLKQAHAACNLPVLR
KDFMIDAYQVYEARAMGADCILLIAAAIDLAKMRELETIAHSLGMAVLVEVHNGEELELA
LQLDTPLLGINNRNLRTFEVTLDTTLGLLARIPAHKIVVTESGIFTQADVALMRQNHVHT
FLVGEAFMRQPEPGVELAKVFA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacattctgaataaaattatcgccacaaaaacacgagaagtggctgcggctaaa
gccaacaaatcactagaaatggtgcagcaggaagctgccacagccagcccaaccagagat
tttgtaggtagcatacgcgccaaaatcgccaacaaccaagcggcggtgattgcagagatc
aaaaaggccagcccatctaaaggtgtgattcgtgctgactttcagcctgcagctatcgca
gccagctacgagcagggcggtgctgcgtgcttgtcagtactcactgacatcgaatacttc
caaggctcgccggaatacctgaagcaagcgcatgccgcatgtaacttaccggtattacgc
aaagactttatgatagacgcttatcaagtctatgaagcccgcgctatgggtgcggattgc
attctactgattgccgccgccattgatttggccaaaatgcgtgaactggaaaccatcgca
catagcttaggcatggcagtattggtagaagtgcataatggcgaagaactagaactcgcg
ttgcaactcgacacgccgctactcggcatcaacaaccgtaacttacgcacctttgaagtc
acactggataccacattaggcttattggcacgcattcctgcgcacaaaatcgtggtgacc
gagtctggcatcttcacccaggctgacgtggcgctgatgcgacaaaatcatgtgcacaca
ttcttggtgggtgaagcgtttatgcgccagcctgagcctggtgttgagctagcaaaagtg
tttgcttaa

DBGET integrated database retrieval system