KEGG   Methylotenera mobilis: Mmol_2175Help
Entry
Mmol_2175         CDS       T00942                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmb  Methylotenera mobilis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mmb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2351757..2352545
Genome map
AA seq 262 aa AA seqDB search
MSDILNKIIATKTREVAAAKANKSLEMVQQEAATASPTRDFVGSIRAKIANNQAAVIAEI
KKASPSKGVIRADFQPAAIAASYEQGGAACLSVLTDIEYFQGSPEYLKQAHAACNLPVLR
KDFMIDAYQVYEARAMGADCILLIAAAIDLAKMRELETIAHSLGMAVLVEVHNGEELELA
LQLDTPLLGINNRNLRTFEVTLDTTLGLLARIPAHKIVVTESGIFTQADVALMRQNHVHT
FLVGEAFMRQPEPGVELAKVFA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacattctgaataaaattatcgccacaaaaacacgagaagtggctgcggctaaa
gccaacaaatcactagaaatggtgcagcaggaagctgccacagccagcccaaccagagat
tttgtaggtagcatacgcgccaaaatcgccaacaaccaagcggcggtgattgcagagatc
aaaaaggccagcccatctaaaggtgtgattcgtgctgactttcagcctgcagctatcgca
gccagctacgagcagggcggtgctgcgtgcttgtcagtactcactgacatcgaatacttc
caaggctcgccggaatacctgaagcaagcgcatgccgcatgtaacttaccggtattacgc
aaagactttatgatagacgcttatcaagtctatgaagcccgcgctatgggtgcggattgc
attctactgattgccgccgccattgatttggccaaaatgcgtgaactggaaaccatcgca
catagcttaggcatggcagtattggtagaagtgcataatggcgaagaactagaactcgcg
ttgcaactcgacacgccgctactcggcatcaacaaccgtaacttacgcacctttgaagtc
acactggataccacattaggcttattggcacgcattcctgcgcacaaaatcgtggtgacc
gagtctggcatcttcacccaggctgacgtggcgctgatgcgacaaaatcatgtgcacaca
ttcttggtgggtgaagcgtttatgcgccagcctgagcctggtgttgagctagcaaaagtg
tttgcttaa

DBGET integrated database retrieval system