KEGG   Mycobacterium sp. MCS: Mmcs_0039Help
Entry
Mmcs_0039         CDS       T00367                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mmc  Mycobacterium sp. MCS
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
49951..50958
Genome map
AA seq 335 aa AA seqDB search
MGKKLVIGASGFLGSHVTRRLVERGDDVRVLIRHTSSTRGIDGLPVECHYGDIFDDDAVR
AAVAGCDVVYYCVVDARAWLRDPTPLWRTNVEGLQRVLDVVADADLYRFVFTSSIATIGI
ADSGPATEELSHNWLDRAGEYVRTRVAAEDLVLRYHRERALPAVAMCVSNTYGPDDWLPT
PHGGLVAAAVRGKLPFYIDGAQAEVVGVRDAADALILAGERGRPGERYIVSERFMTAREI
YQTACAAVGVTPPQRGVPIRALAAAAVPSAWLARLRRRDTRFTPLTIRLMHIMSPMDHSK
AERELGWRPAPTTDALAEAAEFFVGNRRRPAEDRR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggggaagaagctcgtcatcggggccagcgggttcctgggctcccacgtcacgcgccga
ctggtcgagcgcggcgacgacgtacgcgtgctcatccgccacaccagctcgacccgcggc
atcgacggactgcccgtcgaatgccactacggcgacatcttcgacgacgacgccgtgcgc
gccgcggtggcgggctgcgacgtcgtctactactgcgtggtcgacgcccgcgcatggctg
cgggacccgacaccgctgtggcgcaccaacgtcgaagggctgcaacgggtactcgacgtc
gtcgccgacgccgacctgtaccgcttcgtgttcaccagttccatcgccacgatcggcatc
gccgactccggcccggcgaccgaggagctgtcccacaactggctcgaccgggcgggcgag
tacgtccggacccgcgtcgccgccgaggacctggtgctgcgataccaccgcgaacgggcc
ctacccgcggtggcgatgtgcgtgtccaacacctatggccccgacgactggctgccgaca
ccgcacggcggactcgtcgccgccgcggtgcgcgggaagctgccgttctacatcgacggc
gcccaggccgaggtggtcggtgtgcgcgatgcggccgatgccctcatcctggccggcgaa
cgcggacgaccgggggagcgctacatcgtctccgaacggttcatgaccgcccgtgagatc
taccagaccgcttgcgccgcagtcggagtgacaccgccacagcgcggtgtgccgatccgg
gcgctggctgccgccgcggtgcccagcgcgtggctggcccgcctgcgccgccgcgacacc
cggttcacgccgctgaccatccggctcatgcacatcatgtcgccgatggaccattccaag
gccgaacgcgaactcggatggcgtccggcacccacgacggatgccctcgccgaggccgcg
gagttcttcgtcggcaaccgccgccgacccgccgaggaccgccgctga

DBGET integrated database retrieval system