KEGG   Mycobacterium sp. MCS: Mmcs_0111Help
Entry
Mmcs_0111         CDS       T00367                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00010  Glycolysis / Gluconeogenesis
mmc00071  Fatty acid degradation
mmc00350  Tyrosine metabolism
mmc00625  Chloroalkane and chloroalkene degradation
mmc00626  Naphthalene degradation
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_0111
  Lipid metabolism
   00071 Fatty acid degradation
    Mmcs_0111
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mmcs_0111
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mmcs_0111
   00626 Naphthalene degradation
    Mmcs_0111
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mmcs_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N NAD_binding_2 Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N FAD_binding_3 Mur_ligase 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABG06232
JGI: Mmcs0111
Position
complement(126004..127116)
Genome map
AA seq 370 aa AA seqDB search
MTMTIRGAVLEEIGRPRPFTESAPLSVSELQLDPPGPDELLIRIEAAGLCHSDLSVVDGN
RVRPVPMLLGHEAAGIVEQIGPGGSDLEVGQRVVMTFLPRCGHCTACATGGLTPCEPGTA
ANSAGTLMHGDIRLHRDGQPVHHHLGVSGFATYAVVDRHSVVAVDADVPPVVASLLGCAV
LTGGGAVLNVGKPQPGQTVVVVGLGGVGMAAMITAMAHDGVDVVGIDQLEDKLDRARAMG
INAAYTPEEAAERGLKAAVVIEAVGHPSALETAIAHTAPGGRTITVGLPRPDARISVSPL
GFVAEGRSLIGSYLGSAVPARDIPRFVELWRSGRLPVETLVSSTISLDEINAGMDRLAEG
KAVRQVIEFD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgatccgcggcgccgtcctcgaagagatcggccggccccgccctttcacc
gagtccgcgccgctgtccgtgtccgaactccagctcgatccgcccggccccgacgaactg
ctgatccggatcgaggccgcgggtctgtgccactcggatctctcggtcgtcgacggcaac
cgcgtgcggccggttccgatgctgctcggccacgaagccgccggcatcgtcgagcagatc
ggtccgggcggctccgacctcgaggtgggtcagcgggttgtgatgacgttcctgccgcgc
tgcggccactgcaccgcctgtgccaccggcggtctcaccccgtgcgaaccgggcaccgcg
gccaacagcgccggcaccctcatgcacggcgacatccggctgcaccgcgacggccaaccg
gtgcaccatcacctcggggtgtccggtttcgccacttacgccgtggtggaccggcattcg
gtggtcgccgtcgacgccgacgtcccaccggtcgtcgcgtcgctgctcggttgcgcggtc
ctcaccggcgggggcgcggtgctcaacgtcggcaaaccgcaacccggccagaccgtcgtc
gtggtcggcctcggcggcgtcgggatggccgcgatgatcaccgccatggcgcacgacggc
gtggacgtcgtcgggatcgaccagctggaggacaaactcgaccgagcccgcgcgatgggc
atcaacgccgcctacaccccggaggaggccgctgaacggggcctcaaggcagcggtggtc
atcgaagcggtcggccacccctccgcactcgagaccgcgatcgcgcacaccgctcctggt
ggccgcacgatcaccgtcggcctcccccgccccgatgcgcggatctcggtgtcgccgttg
ggtttcgtcgccgaaggccggtccctgatcggcagttacctcgggtcggcggtgccggcc
cgcgacatcccccggttcgtcgagctgtggcgctctggtcgtctcccggtggaaaccctg
gtgtcctcgacgatctcactcgacgagatcaatgccggtatggaccgcctggccgagggc
aaggccgtccgccaggtcatcgagttcgactag

DBGET integrated database retrieval system