KEGG   Mycobacterium sp. MCS: Mmcs_0118Help
Entry
Mmcs_0118         CDS       T00367                                 

Definition
virulence factor MCE-like protein
Orthology
K02067  
putative ABC transport system substrate-binding protein
Organism
mmc  Mycobacterium sp. MCS
Module
Putative ABC transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
132485..133705
Genome map
AA seq 406 aa AA seqDB search
MAEPRSPVNKPRTPPYKLAGLILLVVFAVIATLVAFQFRGDFTPREKLTMMAARAGLNLD
PGTKVTFNGVEIGRVAEVNAVSVGNDPRARITLEVDTKYMQLIPANVLADISATTVFGNK
YVSFTTPPDPVPQRIKSTDVIDVTSVTTEFNTLFETVVSVAEKVDPVKLNQTLTATAQAL
DGLGDRFGESIVNGNAILADLNPQMPQIRRDVRGLADLGEVYANAAPDLFDGLENAVTTA
RTLNEQRGNLDQALIAAVGFGNTGGEVFERGGPYLVRGAEDLIPTSALLDEYSPALFCTI
RNFHDVEPKISSSLGGNGYSLNTHSEALGAGNPYVYPDNLPRVNAKGGPEGRPGCWQPIT
RDLWPAPYLVLDTGASLAPYNHLELGQPIAIEYVWGRQIGENTINP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccgcgttcccccgtcaacaagccccgcacgccgccctacaagctggccggc
ctgatcctgctggtggtcttcgccgtcatcgccacgctggtcgcgttccagttccgcggt
gacttcaccccgcgtgagaagctgaccatgatggcggcccgcgccggtctgaacctcgac
cccggcaccaaggtgaccttcaacggtgtggagatcggccgcgtcgccgaggtcaacgcg
gtcagcgtcggcaacgatccccgggccaggatcacgctcgaggtcgacacgaagtacatg
cagctgatcccggcgaacgtgcttgcggacatctcggcgaccacggtgttcggcaacaag
tacgtctcgttcaccacgccgcccgacccggtcccgcagcggatcaagtccaccgacgtc
atcgacgtgaccagcgtgacgacggagttcaacacgctgttcgagaccgtcgtgtcggtg
gcggagaaggtggacccggtcaagctgaaccagaccctgaccgcgaccgcacaggccctg
gacggcctcggcgaccgcttcggcgagtcgatcgtcaacggcaacgcgatcctggccgac
ctcaacccgcagatgccgcagatccgacgggacgtccgcgggctggccgacctcggcgag
gtgtacgccaacgccgcccccgatctgttcgacgggctggagaatgcggtgaccacggcc
cgcacgctcaacgaacagcgcggcaacctcgatcaggcgctcatcgcggcggtcggcttc
ggcaacaccggcggtgaggtgttcgaacgtggtggtccctacctggtccgcggtgcggag
gacctcatcccgacgagtgcgctgctcgacgagtacagccccgcgctgttctgcacgatc
cgcaacttccacgacgtggagccgaagatctcgtcgtcgctgggcgggaacggctattcg
ctcaacacccactccgaggccctcggcgcgggcaacccgtacgtgtacccggacaacctg
ccgcgcgtgaacgccaagggtggtccggaggggcggcccggctgctggcagcccatcacc
cgggatctgtggcccgcgccgtacctggtcctcgacacaggcgcctcccttgcgccgtac
aaccatctcgaactcggtcaaccgatcgccatcgaatacgtctggggacgccagatcggg
gagaacacgatcaacccatga

DBGET integrated database retrieval system