KEGG   Mycobacterium sp. MCS: Mmcs_0118Help
Entry
Mmcs_0118         CDS       T00367                                 

Definition
(RefSeq) virulence factor MCE-like protein
  KO
K02067  
phospholipid/cholesterol/gamma-HCH transport system substrate-binding protein
Organism
mmc  Mycobacterium sp. MCS
Pathway
ABC transporters
Module
Mce transport system
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mmcs_0118
Transporters [BR:mmc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter [MD:M00669]
    Mmcs_0118
   Phospholipid transporter [MD:M00210]
    Mmcs_0118
   Mce system transporter [MD:M00670]
    Mmcs_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
132485..133705
Genome map
AA seq 406 aa AA seqDB search
MAEPRSPVNKPRTPPYKLAGLILLVVFAVIATLVAFQFRGDFTPREKLTMMAARAGLNLD
PGTKVTFNGVEIGRVAEVNAVSVGNDPRARITLEVDTKYMQLIPANVLADISATTVFGNK
YVSFTTPPDPVPQRIKSTDVIDVTSVTTEFNTLFETVVSVAEKVDPVKLNQTLTATAQAL
DGLGDRFGESIVNGNAILADLNPQMPQIRRDVRGLADLGEVYANAAPDLFDGLENAVTTA
RTLNEQRGNLDQALIAAVGFGNTGGEVFERGGPYLVRGAEDLIPTSALLDEYSPALFCTI
RNFHDVEPKISSSLGGNGYSLNTHSEALGAGNPYVYPDNLPRVNAKGGPEGRPGCWQPIT
RDLWPAPYLVLDTGASLAPYNHLELGQPIAIEYVWGRQIGENTINP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccgcgttcccccgtcaacaagccccgcacgccgccctacaagctggccggc
ctgatcctgctggtggtcttcgccgtcatcgccacgctggtcgcgttccagttccgcggt
gacttcaccccgcgtgagaagctgaccatgatggcggcccgcgccggtctgaacctcgac
cccggcaccaaggtgaccttcaacggtgtggagatcggccgcgtcgccgaggtcaacgcg
gtcagcgtcggcaacgatccccgggccaggatcacgctcgaggtcgacacgaagtacatg
cagctgatcccggcgaacgtgcttgcggacatctcggcgaccacggtgttcggcaacaag
tacgtctcgttcaccacgccgcccgacccggtcccgcagcggatcaagtccaccgacgtc
atcgacgtgaccagcgtgacgacggagttcaacacgctgttcgagaccgtcgtgtcggtg
gcggagaaggtggacccggtcaagctgaaccagaccctgaccgcgaccgcacaggccctg
gacggcctcggcgaccgcttcggcgagtcgatcgtcaacggcaacgcgatcctggccgac
ctcaacccgcagatgccgcagatccgacgggacgtccgcgggctggccgacctcggcgag
gtgtacgccaacgccgcccccgatctgttcgacgggctggagaatgcggtgaccacggcc
cgcacgctcaacgaacagcgcggcaacctcgatcaggcgctcatcgcggcggtcggcttc
ggcaacaccggcggtgaggtgttcgaacgtggtggtccctacctggtccgcggtgcggag
gacctcatcccgacgagtgcgctgctcgacgagtacagccccgcgctgttctgcacgatc
cgcaacttccacgacgtggagccgaagatctcgtcgtcgctgggcgggaacggctattcg
ctcaacacccactccgaggccctcggcgcgggcaacccgtacgtgtacccggacaacctg
ccgcgcgtgaacgccaagggtggtccggaggggcggcccggctgctggcagcccatcacc
cgggatctgtggcccgcgccgtacctggtcctcgacacaggcgcctcccttgcgccgtac
aaccatctcgaactcggtcaaccgatcgccatcgaatacgtctggggacgccagatcggg
gagaacacgatcaacccatga

DBGET integrated database retrieval system