KEGG   Mycobacterium sp. MCS: Mmcs_0187Help
Entry
Mmcs_0187         CDS       T00367                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_0187
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmcs_0187
Enzymes [BR:mmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mmcs_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(207093..209390)
Genome map
AA seq 765 aa AA seqDB search
MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQRGTIPVDHTVAREAAT
AFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWATSAKGSTDEDPGPDLA
SYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPPVDFRPFIIADADTGHGG
DPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMG
VPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYKSCFLAMMRSFHDAGVTALN
GHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGDPSNDALYDDVESQFIAAWEE
DAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRASLYTAGKKARELGVDVDWDCE
LAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKTADLADAREFAEAIHAEYPDKML
AYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFITYGGHQVDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGGEVLELGIYGERDGGEEKLADVLVDP
IKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLWLVHRFKADAVYYVTPTDDNVYQTEKM
KSHGIFSDVHKDVGEIIVAEVNRARIEELLAPDREALGRLIRKED
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccacgcggaatccaagaccggcacgtcattcgaccaagaggtcgccgagacg
cagcgctatctcgacagcccccggttcgagggcatcacccgcctctacacggcccgacag
gtcgtcgaacagcgcgggacgatccccgtcgaccacaccgtggcccgcgaggcggcgacg
gcgttctacccgcgccttcgcgaactgttctcccagggcaagagcatcacgacattcggc
ccctactcccccgggcaggccgtgaccatgaaacgagccggcatcgagggcatctacctg
ggcggctgggccacctccgccaaggggtccaccgacgaggaccccggtcccgatctggcc
agctatccgctcagccaggtgcccgacgaagccgccggtctggtgcgcgcactgctcacc
gccgaccgcaaccagcactacctccggctgcggatgagcgaggagcaacgggcggcagcg
ccgcctcccgtcgacttccggcctttcatcatcgccgacgccgacaccggtcacggtggt
gatccccacgtgcgcaacctgattcgacggttcgtcgaggccggcgtacccgggtaccac
atcgaggaccagcgccccggcaccaagaagtgcggacatcagggcggcaaggtcctggtg
ccgtcggacgagcagatcaaacgcctcaacaccgcgcggttccaactcgacatcatgggc
gtaccgggcatcatcgtcgcccgcaccgacgccgaggccgccaacctgatcgacagccgc
gccgacgaacgcgatcaacccttcctgctcggcgcgacgaatctgtccattccgtcgtac
aagtcgtgcttcctggcgatgatgcgcagcttccacgacgcgggcgtcaccgcactcaac
ggccacctgctctactggctgcccgacggcgagtacgagaccgcgcgcgcctggctggaa
cgccacggtatcgccgacgtcatcgccaaggccgtcgagcagtggcgttccgacggcgac
ccgagcaacgatgcgctctacgacgacgtcgaatcgcagttcatcgcggcctgggaggag
gacgccgggctgaagacctacgccgagacggtggccgcccgcctcgagttcgccgagggt
gacggcgaggcgtacgcgatgggcgtcgacgagtggacgcagttcgccaagcgggcatcg
ctgtacaccgccggcaagaaggccagggagttgggcgtcgacgtcgactgggactgcgag
ctggcgaagaccccggaggggtattaccaactgcgcggcggcattccgtacgcgatcgcc
aaacaactggccgccgcaccgttcgccgacatcctgtggatggagaccaagaccgccgac
ctcgccgacgccagggagttcgccgaggccatccacgccgagtaccccgacaagatgctc
gcctacaacttgtcgccgtcgttcaactgggacaccaccggtatgaccgatgacgagatg
cgggcgttccctgaggaactcggcaagatgggcttcgtcttcaacttcatcacctacggc
ggacaccaggtcgacggggtggcctccgaggagttcgccaccgccctgcggcaggacggc
atgctcgcgctggcccgtctgcagcgcaagatgcggctcgtcgaatcgccctaccgcaca
ccgcagacgctcgtcggcgggccgcgcagcgacgccgccctgctcgcctcgtccggccgc
accgccaccaccaaggcgatgggcaagggctccacacagcatcagcacctggtgcagacc
gaggtgcccaagaagctgctcgaggactggctcgcgatgtggagcgagcactatcagctg
ggcgagaagttgcgggtgcagttgcggccccggcgcgcgggcggtgaagtgctcgaactc
ggcatctacggcgagcgcgacggcggcgaggagaaactcgccgacgtgctggtcgacccg
atcaaggaccggtacggccgcagcatcctgacggtgcgcgaccagaacacctatgccgag
aagttgcgcaagaagcggctgatgacgctggtccacctgtggctggtgcaccgattcaag
gccgacgcggtgtactacgtgacaccgaccgacgacaacgtctaccagaccgagaagatg
aagtcgcacggcattttcagcgatgtgcacaaggacgtcggggagatcatcgttgccgag
gtcaaccgcgcgcgcatcgaggagctgctggcccccgaccgggaggcgctcggccggctg
atccgcaaggaagactga

DBGET integrated database retrieval system