KEGG   Mycobacterium sp. MCS: Mmcs_0302Help
Entry
Mmcs_0302         CDS       T00367                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mmcs_0302
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Mmcs_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(339151..340755)
Genome map
AA seq 534 aa AA seqDB search
MNFGAMNYDVIVVGFGAAGAAAAIEAADRGARVLVLDRGYGGGATALSGGIVYAGGGTAE
QHAGGYHDSVEDMRAYLESEVGDSVSGETLDRFCRQSPAMIEWLKAQGVEFRGGEVPTYK
TSYPTDDFYLYYSGNEKAYPYAGRARPVPRGHRVLARGMSSGKVLFDRLARSARHKGVEF
IPLAQVHSLIQDDDGRIAGVRYRALDPAHPNARKHKVLTKLTGKAGTWMPGLVEGLVARA
EEMRTGASVDAEARAPAVILAAGGFVHNREWMQAHAPQFMKVSPLGTVGDDGTGIALGLA
AGGVTGKMDNVTAWRFLSPPSAFLEGLTVGADGRRIANEDLYGATHGNVLMRDFGGTGWA
IYDAQTWRKVKSQIRTQTQIFQRLQLIYLFTIGHKKAASIEDLAAENGIDAEGLRRTVDE
YHRGLDNGAGDPAHKDPELCPPLLTPPFYSIDISADSSMFFPIPGLTLGGLLVDESTGEI
LGADGESVPRLYAAGRNAVGVCSKSYVSGLSLADCIFSGRRAGAHAADGLGQPR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcggtgccatgaactacgacgtcatcgtcgtcggattcggcgcagccggtgcg
gcagccgcgatcgaggccgccgaccgtggcgcacgcgtgctcgtgctcgaccgcggttac
ggcggcggtgcgacggcgttgtccggcgggatcgtctacgccggcggcggcaccgccgaa
cagcacgccggcggctaccacgacagcgtcgaggacatgcgggcctacctcgagtccgaa
gtcggcgactccgtgtccggcgagacactggaccggttctgccggcagagcccggcgatg
atcgagtggctcaaggcgcagggggtcgagttccgcggcggcgaggtgcccacctacaag
acctcgtatccgaccgacgacttctacctgtactactccggcaacgagaaggcctatccg
tacgcaggccgcgcccggccggtaccgcgcggccaccgcgtcctcgcgcgcggaatgagt
tccggcaaggtcctgttcgaccgcctcgcccgatcggcgagacacaaaggcgtggaattc
atccccctggcccaggtgcacagcctcatccaggatgacgacggccgcatcgccggtgtc
cgctaccgcgcgttggatccggcgcacccgaacgcgcgcaagcacaaggtgctgaccaag
ctcaccgggaaggcgggcacctggatgcccggactggtcgagggcctcgtcgcgcgcgcg
gaggagatgcgcaccggtgcttccgtggacgcggaggcccgcgcacccgcggtgatcctc
gcggcgggaggcttcgtccacaaccgagagtggatgcaggcccacgcaccgcagttcatg
aaggtgtccccgctgggaaccgtcggcgacgacggcaccggcatagcgctggggctcgcc
gccggcggggtgaccggcaagatggacaatgtgacggcctggcgattcctctcgccgccg
agcgcgttcctcgaggggctcaccgtcggggcggatggacggcgcatcgccaacgaggac
ctctacggcgccacccacggcaacgtgctgatgcgtgacttcggtggcaccggatgggcg
atctacgacgcgcaaacgtggcggaaggtgaaaagccagatccgcacccagacccagatc
ttccaacgcctgcagctgatctacctgttcacgatcggccacaagaaggccgcctcgatc
gaggacctcgccgccgagaacgggatcgacgccgaaggccttcgacgcacggtcgacgag
taccaccgcggcctcgacaatggtgccggggatcccgcacacaaggaccccgaactctgt
ccgccgctgctcaccccgccgttctactcgatcgacatctcggccgactcctcgatgttc
ttcccgattcccggcctgaccctcggcggcctgctggtcgacgagagcaccggcgaaata
ctgggtgccgacggggaatcggtgccgcgtctgtacgccgccggacgcaacgcggtgggc
gtgtgctccaagagctacgtcagcgggctgtccctcgccgactgcatcttcagcggtcgg
cgcgcgggcgcgcacgccgcggacggattgggacagccacggtga

DBGET integrated database retrieval system