KEGG   Mycobacterium sp. MCS: Mmcs_0659Help
Entry
Mmcs_0659         CDS       T00367                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_0659
   01230 Biosynthesis of amino acids
    Mmcs_0659
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_0659
  Energy metabolism
   00680 Methane metabolism
    Mmcs_0659
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmcs_0659
Enzymes [BR:mmc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mmcs_0659
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mmcs_0659
  Exosomal proteins of melanoma cells
   Mmcs_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
720299..721045
Genome map
AA seq 248 aa AA seqDB search
MGDSTLILLRHGESEWNAKNLFTGWVDVDLTDKGRAEATRAGELIADLDRLPDVLYTSLL
RRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETKEKYGEEQFMAWRRSYD
TPPPPIEAGSEYSQDRDPRYADIDGGPLTECLADVVARFVPYFEQTIVPDLREGRTVLIA
AHGNSLRALVKYLDGMSDEDVVGLNIPTGIPLRYDLDSDLKPTVAGGTYLDPEAAAAGAA
AVASQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggagattccacgctgatcctgcttcgtcacggcgaaagtgaatggaacgcgaagaac
ctgttcaccgggtgggtcgacgtcgacctgaccgacaagggccgggccgaggccacgcgg
gcgggtgagctgatcgccgatctggaccggttgcccgacgtgctgtacacctcgctgctg
cggcgcgcgatcaccacggccaacatcgcgttggacaaggcggaccggcactggatcccg
gtgcaccgggactggcggctcaacgagcggcactacggggcgctgcaggggctgaacaag
gccgagaccaaagagaagtacggcgaggagcagttcatggcctggcggcgcagctacgac
accccgccgccgccgatcgaggccggcagcgagtacagccaggaccgcgatccgcgctac
gccgacatcgacggcggaccgctcaccgaatgcctggccgacgtggtggcccgcttcgtg
ccctacttcgagcagacgatcgtgccggatctgcgcgagggcaggaccgtgctgatcgcc
gcgcacggcaactcactgcgtgcgctggtcaagtacctcgacggcatgtccgacgaggac
gtggtcgggctgaacatcccgaccggcataccgctgcgctacgacctggactccgatctg
aagccgacggtggcaggcggcacgtacctcgatccggaggccgcggcggccggcgcggcg
gccgtggcatcccagggcgcgaagtaa

DBGET integrated database retrieval system