KEGG   Mycobacterium sp. MCS: Mmcs_0679Help
Entry
Mmcs_0679         CDS       T00367                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmcs_0679
Enzymes [BR:mmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mmcs_0679
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmcs_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
737684..738655
Genome map
AA seq 323 aa AA seqDB search
MRQRPRRLRSTPAMRRLVAETSLEPRHLVLPMFVADGIDEPRPISSMPGVVQHTRDSLRR
AAADAVAAGVGGLMLFGVPRDEDKDPRGSIGMDPEGILNVALRDLAKDLGEDTVIMADTC
LDEFTDHGHCGVLDDRGRVDNDATNQQYVKLAVAQAQSGAHVVAPSGMMDGQVAAIRDGL
DGAGHTDVAILAYAAKFASAFYGPFREAVGSSLQGDRRTYQQDSGNAREALREIELDLAE
GADMVMVKPAMSYLDVVRACADISPVPVAAYQISGEYAMISAAAANGWIDLQASALEALT
GIRRAGADIVLTYWAADVAGWLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagcgtccgcgtaggttgcgttcgacaccggccatgcgtcggctggttgctgaa
acctccctggagccaaggcatctcgtgctgccgatgttcgtcgccgacgggatcgacgag
ccgcggccgatctcgtcgatgcccggggtggtgcaacacacccgcgactcgttgcgccgc
gcggccgccgacgcggtggccgccggggtgggcgggctgatgctgttcggggtgccccgc
gacgaggacaaggatccgcgcggttcgatcggcatggaccccgagggcatcctcaacgtc
gcgctgcgcgacctcgccaaggacctcggcgaggacaccgtgatcatggccgacacctgc
ctcgacgagttcaccgatcacggccactgcggggtgctggacgaccggggtcgggtcgac
aatgacgcgaccaatcagcagtacgtgaaacttgctgtggcccaggcgcagtcgggtgcc
cacgtggtcgcgccgagcgggatgatggacggtcaggtggccgccatccgcgacgggctg
gacggcgcaggacacaccgacgtggcgatcctggcgtatgcggccaagttcgcctcggcg
ttctacggcccgttccgcgaagccgtcggatcgagtctgcagggcgaccgccgcacctat
cagcaggacagcggcaacgcgcgcgaggctctgcgcgagatcgaactggacctcgccgag
ggcgccgacatggtgatggtgaagccggccatgtcctacctggacgtggtgcgcgcatgc
gccgacatctccccggtgccggtcgcggcgtaccagatctccggtgagtacgcgatgatc
agcgccgccgccgccaacggctggatcgatctgcaggcgtctgccctcgaagcgctcacc
ggtatccggcgggccggtgcggacatcgtgttgacctactgggcggccgacgtggccggc
tggctgggatga

DBGET integrated database retrieval system