KEGG   Mycobacterium sp. MCS: Mmcs_0897Help
Entry
Mmcs_0897         CDS       T00367                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmcs_0897
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mmcs_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(992176..993918)
Genome map
AA seq 580 aa AA seqDB search
MSVGALAVTGLLRAFTDAEVFEPADVHVARRLTDMAKEPDESVALAVAFAVRALRNGSVC
VDLRAVADQVGLPDLPWRDPEAWLTAVRASPLTGTPPVLRLYSGSSGDLLYLDRYWREEQ
QVCDDVLALLESSPPGAVPGLDRLFPTADFPEQRVAAEIALSQSLTVLTGGPGTGKTTTV
ARLLALLAEQASLQNRPPLRIALAAPTGKAAARLLEAVHLQIAGLDAVDRDRLPELTAST
LHRLLQRRRDNASRFRHHRENRLPHDVIVVDETSMVSLTLMARLLEAVRPDSRLLLVGDA
DQLASVEAGAVLADLVDGLGARDDVRIARLVTSHRFGAPIGALAKAIRDGETDTVIGLLR
DGGPDIEWFDTDNPADRLRKVLVPHALRLREAAILGDGPAALATLDEHRLLCAHRRGPYG
VRHWNRQVERWLTDATGEPIWSDWYAGRPLLVTANDYGLRLYNGDTGVTVVRGDGLTAVV
GSGAGPVEFSTSRLADVETVHAMTIHKSQGSQAREVTVLLPDEESRLLTRELFYTAVTRA
KAKVRVVGSEAAVRAAIERRVVRASGLAQRLGGSGRTAST
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcggcgccctcgccgtcaccgggttgctgcgcgccttcaccgacgcggaggtg
ttcgaacccgccgatgtgcacgtcgcgcgccggctcaccgacatggcgaaggaacccgac
gaatccgtcgcgctcgccgtggcattcgcggtgcgcgccctgcgcaacgggtcggtctgt
gtggacctgagggccgtcgcggaccaggtcggattgcccgacctgccctggcgcgacccc
gaggcgtggctgaccgcggtgcgggccagtccgctgaccgggacgccgccggtgctgagg
ctctactccggctcctcgggtgacctgctctacctcgaccgttactggcgcgaagaacaa
caggtgtgcgacgacgtgctcgcgctgctggaatcgtcgccgccgggtgcggtgcccgga
ctcgaccgcctgtttcccaccgccgacttccccgagcaacgcgtcgccgcggaaatcgcg
ctgtcgcaatcacttacggtgctgaccggcggccccggcaccggtaagacgacgacggtg
gcgcggctgttggcgctgctcgccgaacaggcctcgctgcagaaccggccaccgctgcgc
atcgcgctggccgccccgaccggtaaggccgcggcccgcctgctcgaggccgtacacctg
cagatcgccggactcgacgccgtcgaccgtgaccgtctgcccgaactgaccgcctcgaca
ctgcaccggctgctgcagcggcgccgggacaacgcgtcgcggttccgccaccaccgggag
aaccggctgccgcacgacgtgatcgtcgtcgacgagacgtcaatggtgtcgctgacgctg
atggcccggctcctcgaagccgtgcggcccgacagccggttgctgctggtgggcgacgcc
gaccagttggcgtcggtggaggccggggccgtgctggccgacctcgtcgacgggctgggc
gcacgcgacgacgtgcgcatcgcccggctggtcacctcgcaccgcttcggcgcgccgatc
ggggcgctggcgaaggcgatccgcgacggcgagaccgacaccgtgatcgggctgctgcgc
gacggcggccccgacatcgaatggttcgacaccgacaacccggccgaccggttgcgcaaa
gtgcttgtgccgcatgcgctccggctgcgggaggcggccatcctcggggatgggccggca
gcgttggccacgctcgacgaacaccgtctgctgtgcgcgcaccggcgcggaccgtacggc
gtgcggcactggaaccgacaggtcgaacgctggctcaccgacgcgaccggcgagccgatc
tggtcggactggtacgccgggcggccgctgctggtcaccgccaacgattacgggctgcgg
ctctacaacggcgacaccggtgtgacggtcgtgcgcggcgacgggctcacggcggtggtg
ggctcgggcgccgggccggtcgagttctcgaccagccggctcgccgacgtcgagaccgtg
cacgcgatgaccatccacaagagccagggcagccaggcccgggaggtgaccgtgctgctc
cccgacgaggagtcgcggctgctgacccgcgagctgttctacaccgcggtcacccgcgcg
aaggcgaaggtgcgggtggtcggctcggaggcggcggtgcgggcggcgatcgagcggcgt
gtggtgcgggcgtcggggctggcgcagcggctcggcgggtcggggcgcacagcgagcacg
taa

DBGET integrated database retrieval system