KEGG   Mycobacterium sp. MCS: Mmcs_1170Help
Entry
Mmcs_1170         CDS       T00367                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mmcs_1170
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Mmcs_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1266077..1267852
Genome map
AA seq 591 aa AA seqDB search
MQPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFADEDFAKTSWDLRNFLWAPQL
GCFGIQRIHLLRDVLILAGAGVGGGSLNYANTLYVPREPFFNDPQWKHITDWNEELLPHY
EQAQRMLGVVTNPTFTDADRVVKEVAEDMGVGDTFVPTPVGVFFGPDGQKAPGKTVPDPY
FGGVGPARRGCIEVGECMTGCRHNGKNTLVKNYLYLAERAGTEVHPLTTVTSFEQRADGV
WEVSTVRTGRKVRRQKRTFTANHVVLAAGTFGTQKLLFKMRDAGKLPELSDRLGMLTRTN
SESIVGAGKFEVTDDLDLTHGVAITSSIHPTSDTHIEPVRYGKGSNAMGLLQTLMTDGAG
PEGTDVPRWKQLFHNAKADPRGTMRLLNVRRWSERTLIALVMQNLDNSITTFTKRTKFGT
RRLTSKQGHGEPNPTWIPVGNEVTRRIAEKIDGVAGGTWGELFNIPLTAHFLGGAAIGDS
AEHGVIDPYHRVYNYPTLYVTDGAAISANLGVNPSLTISAQAERAASLWPNKGEEDLRPA
QGEGYRRLDPIRPAQPVVPAGAPAALDWNASREEVNRRDPTTAEASEARGA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgactacgacgtcctcatcatcggttcggggttcggtggcagcgtcaccgcg
ctgcggctcaccgagaagggctatcgggtcggcgtactcgaagcgggccgccgcttcgcc
gacgaggacttcgccaagacgtcgtgggatctgcggaacttcctgtgggcgccgcaactg
ggctgcttcggcatccagcgcattcatctgctccgcgacgtcctcatcctggccggcgcg
ggtgtcggcggcggatcgctcaactacgccaacaccctctacgtcccgcgtgagccgttc
ttcaacgacccgcagtggaagcacatcaccgactggaacgaagagctgctgccgcactac
gagcaggcccagcggatgctcggcgtggtcacgaacccgacgttcaccgacgccgaccgc
gtcgtgaaggaagtcgccgaggacatgggcgtcggcgacaccttcgtcccgacgccggtg
ggcgtgttcttcggccccgacgggcagaaggccccgggcaagacggtgcccgacccctac
ttcggcggtgtcggcccggcccgcaggggttgcatcgaggtcggcgaatgcatgacgggc
tgccgccacaacggcaagaacaccctggtgaagaactacctctacctcgccgagcgggcg
ggcaccgaggtacatccgctgaccaccgtgaccagcttcgaacagcgcgccgacggcgtc
tgggaggtgagcaccgtgcgcaccggccgcaaggtgcgccgccagaagcgcaccttcacc
gccaaccatgtcgtccttgcggcgggcacgttcggcactcagaagctgctgttcaagatg
cgtgacgccgggaagctccccgagctgtccgaccggctgggcatgctgacccggaccaac
tcggaatccatcgtcggcgccgggaaattcgaggtcaccgacgacctcgacctcacccac
ggcgtggcgatcacttcgtcgatccacccgacctccgacacccacatcgaaccggtgcgc
tacggcaagggctccaatgcgatggggctgctgcagacactgatgaccgacggcgccggc
ccggagggcaccgacgtgccgcgctggaagcagctgttccacaacgccaaagcggatccg
cgcggcaccatgcgactgctcaacgtgcggcgctggagcgaacggacgctgatcgcgctg
gtcatgcagaacctcgacaactccatcaccaccttcaccaagcgcacgaagttcggcacc
cgccggctgacgagcaaacagggccacggtgagccgaacccgacgtggatcccggtgggc
aacgaggtgacgcggcggatcgccgagaagatcgacggcgtcgcgggcggcacctggggc
gaattgttcaacatccccctgacggcacacttcctcggcggcgccgccatcggcgacagc
gccgagcacggagtcatcgacccctaccaccgcgtctacaactatccgacgctgtacgtc
accgacggggcggcgatctcggccaacctcggcgtcaacccgtccctgaccatcagcgca
caggcggaacgggcggcctcgctgtggccgaacaagggcgaagaggatctgcgacccgca
cagggcgaggggtaccgccgcctggacccgatccgccctgcgcagcccgtggtgcccgcc
ggtgcgcccgcggccctggactggaacgccagccgcgaggaggtcaaccgccgcgacccc
accaccgccgaggcttccgaggcgcgcggcgcctga

DBGET integrated database retrieval system