KEGG   Mycobacterium sp. MCS: Mmcs_1713Help
Entry
Mmcs_1713         CDS       T00367                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00010  Glycolysis / Gluconeogenesis
mmc00071  Fatty acid degradation
mmc00350  Tyrosine metabolism
mmc00625  Chloroalkane and chloroalkene degradation
mmc00626  Naphthalene degradation
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_1713
  Lipid metabolism
   00071 Fatty acid degradation
    Mmcs_1713
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mmcs_1713
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mmcs_1713
   00626 Naphthalene degradation
    Mmcs_1713
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mmcs_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C 3HCDH_N adh_short TrkA_N Pyr_redox XdhC_C Met_10 NAD_binding_7 UDPG_MGDP_dh_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABG07822
JGI: Mmcs1713
Position
complement(1850362..1851369)
Genome map
AA seq 335 aa AA seqDB search
MDVRSVADPSPPPGGVVVEVHATGLCRSDWHGWAGHDRGITLPHVPGHELVGVVAEVGAG
VEKWRVGDRVTTPFVCGCGRCQWCLEGQAQVCPDQTQPGFTHWGSYAEYVALHAADANLV
AVPDAVGDAAAAGLGCRFATAYRALSARARIRPGEWVTVVGAGGVGLSSVQIAVAFGARV
IAVDREPAALALASRLGAEHTVHADGADVAGRVHDLTGGGSHVAVDAVGSAATCADAIHS
LRRRGRHLQVGLLPDVTGHPAVPMDRVIAWELDVLGSHGMASGDYPGMMRLIEAGTLRPQ
AIVERVVGLTEGATLLSSLSVATPAGVTLIDPRLG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtccggtcggtggccgacccgtcgccgccgcccggcggcgtggtcgtcgaggtg
cacgccaccggcctgtgccggagcgactggcacgggtgggccggccacgaccgcggcatc
acgctcccccacgtacccggccacgaactggtcggcgtcgtggcggaggtcggtgccggc
gtcgagaaatggcgggtcggcgaccgtgtcaccacaccgttcgtctgcgggtgcggccgc
tgccaatggtgcctcgaggggcaggcgcaggtgtgtccggaccagacccagccgggcttc
acgcactggggttcgtacgccgagtacgtggccctgcacgccgccgacgccaacctggtc
gcggtcccggacgccgtcggcgacgccgccgcggcgggactgggctgccgattcgccacc
gcctaccgggcgctgagcgcacgcgcccggatccgccccggcgagtgggtgacggtcgtc
ggggccggcggggtaggactgagcagcgtgcagatcgccgtcgccttcggcgccagggtg
atcgcggtcgaccgggagccggcggcgctcgcgctggcgagccgactgggcgcggagcac
accgtgcacgctgacggcgccgacgtcgcgggccgggtccacgacctcaccggcgggggc
agccatgtcgccgtggacgcggtcggttctgcggcgacgtgcgcggatgccatccacagc
ctgcgacgccgcggacgtcacctccaggtcggcctgctgcccgatgtcaccgggcatccg
gcggtgccgatggaccgggtcatcgcgtgggaactcgacgtcctgggcagccacggcatg
gccagcggggactaccccggaatgatgcggctgatcgaggcgggaacgttgcgcccgcag
gcaatcgtcgagcgcgtcgtcgggctcaccgaaggcgccacgctcctgtcgtcgctgagc
gtcgcgaccccggcaggggtcacgctgatcgacccgcggctcggctga

DBGET integrated database retrieval system