KEGG   Mycobacterium sp. MCS: Mmcs_1868Help
Entry
Mmcs_1868         CDS       T00367                                 

Definition
glycoside hydrolase family protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2012711..2014276)
Genome map
AA seq 521 aa AA seqDB search
MSDDARVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSASYLPLMRVLRRLAGEGRDH
LLTLGMTPVVTAQLDDPYCLTGMHSWLANWQLRALEAATLRASSDTTPACTPEALRAFGV
REQGEAELALEEFATLWRHGGSPLLRELVDAGTVELLGGPLAHPFQPLLNPRLREFALRE
GLADAGQRFAHTPRGIWAPECAYAPGMEADYAAAGVGHFMVDGPSLHGDTALGRPVGHSG
VVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHVTGLKPARVTGRNVPSSAKAPYEPD
RADAAIDAHVADFVQVVRRRLTDESERIGRPAHVVAAFDTELFGHWWYEGPEWLARVLRA
LPEAGVRVGTLSDAVDGGFVGAPVDLPPSSWGSGKDWQVWAGDQVTDFVRLNAEVVDTAL
STVDKALTQRASVGSPTPRDTVADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAH
ATREIADALAAGRREQAQRLADGWNRADGLFGALDARRLPR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgacgctcgggtaccggggctgttcaccctcgtcctgcacacgcatctgccg
tggctggcgcaccacggccgctggccggtcggcgaggagtggctctaccagtcgtggtcg
gcgtcgtacctgccgctgatgcgcgtgctgcgcaggctggccggggagggccgcgaccat
ctgctcaccctcgggatgacaccggtggtgaccgctcagctcgacgacccctactgcctg
accgggatgcacagctggctggcgaactggcagctgcgggcactggaggccgccaccctg
cgcgcctcctcggacaccacaccggcgtgcacaccggaagcgttgcgcgccttcggtgtt
cgcgagcagggcgaagcggagctggcgctcgaggagttcgccacactgtggcgccacggc
ggcagtccgctgctgcgtgagctcgtcgacgcgggcaccgtcgaactgctgggcgggccg
ctggcgcatccgttccagccgttgctcaacccccgactgcgggagttcgcgctgcgcgaa
gggctcgccgacgccggacagcgcttcgcgcacaccccgcgcggcatctgggccccggag
tgcgcgtacgccccgggcatggaggccgactatgccgcggcgggcgtcggccacttcatg
gtcgacggcccgtcgctgcacggcgacaccgcgctaggccgccccgtcggccactccggc
gtcgtcgcgttcggtcgcgacctgcaggtcagctaccgcgtgtggtcgcccaagtccggc
tatcccggccacgccgcctaccgcgacttccacacctacgaccacgtcaccgggttgaag
ccggcgcgggtcaccgggcgcaacgtgccgtcgtcggccaaagccccatacgaaccggac
cgcgccgacgccgccatcgacgcccacgtcgccgacttcgtgcaggtggtgcggcggcgg
ctgacggacgagagcgagcggatcggccgcccggcgcacgtggtcgccgccttcgacacc
gaactgttcggccactggtggtacgaggggccggagtggctggcccgcgtactgcgggcg
ctgccggaagccggtgtgcgggtgggcacgctcagcgatgccgtcgacggcggattcgtc
ggcgccccagtcgatctgccgcccagttcgtggggttcgggtaaggactggcaggtctgg
gccggagaccaggtgaccgacttcgtccgactcaacgccgaggtcgtcgacaccgcgctc
agcaccgtcgacaaggcgctcacccagcgcgcgtcggtgggcagcccgacaccgcgggac
accgtcgccgaccagatcctgcgcgagaccctgctgaccgtctcgagcgactggccgttc
atggtgagcaaggactccgcggccgactacgcccgctaccgcgcccacctgcacgcccac
gcgacccgcgagatcgccgacgcactcgcggccggccggcgggagcaggcccagcgcctc
gccgacggctggaaccgcgccgacggcctgttcggcgccctcgacgcccgccggttgccg
cgatga

DBGET integrated database retrieval system