KEGG   Mycobacterium sp. MCS: Mmcs_1892Help
Entry
Mmcs_1892         CDS       T00367                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_1892
   01230 Biosynthesis of amino acids
    Mmcs_1892
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_1892
   00030 Pentose phosphate pathway
    Mmcs_1892
   00051 Fructose and mannose metabolism
    Mmcs_1892
   00052 Galactose metabolism
    Mmcs_1892
  Energy metabolism
   00680 Methane metabolism
    Mmcs_1892
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mmcs_1892
Enzymes [BR:mmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mmcs_1892
Protein phosphatases and associated proteins [BR:mmc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mmcs_1892
Messenger RNA biogenesis [BR:mmc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mmcs_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2035489..2036520
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDVRYGSSVVGFQDGWRGLLENRRIQLRNDARNDR
LLAKGGTILGTARVHPEKLRAGLDQIKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVASEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDVEEVCRLVKQRFVRGDSHFICVVAEGAKPAEGTMQLRQGGMD
EFGHEKFTGVAQQLAIEVEKRVNRDVRVTVLGHVQRGGTPTPYDRVLATRFGVNAADAAH
AGEYGMMVSARGQEIGRVSLADATRRLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcataggagttctcaccggcggcggcgactgtcccggcctgaacgcggtgatccgg
gccgtggtccgcacctgcgacgtccgctacggctcctcggtggtgggtttccaggacggc
tggcgcggattgctggagaaccggcgcatccagttgcgcaacgacgcccgcaacgaccgg
ctactcgccaagggcggcaccatcctcggcaccgcacgggtgcatccggagaagctgcgc
gccgggctcgaccagatcaagcagaccctcgacgacaacggcatcgacgtgctgatcccg
atcggcggggagggcacgctgaccgccgcgcactggctgtccgaggagaacgtgccggtc
gtcggtgtgccgaagaccatcgacaacgacatcgattgcaccgacgtcactttcggccac
gacaccgcgctcacggtcgccagcgaggcgatcgaccgactgcactcgaccgcggaatcg
catcagcgggtgatgctcgtcgaggtgatgggccgccacgccggctggatcgcgctcaac
gccggcctggcctccggtgcgcacatgacgctgatccccgaacaacccttcgacgtcgaa
gaggtgtgccggctggtcaaacagcggttcgtccgcggcgattcgcatttcatctgcgtg
gtggccgagggggccaaacccgccgagggcaccatgcagctacggcagggcgggatggac
gagttcggccacgagaagttcaccggcgtggcccagcagttggcgatcgaggtggagaag
cgggtcaaccgcgacgtgcgggtgacggtgctcggccacgtacagcgcggcggtacgccc
accccctacgaccgggtgctggcgacgcggttcggcgtgaacgccgccgacgccgcacac
gccggtgagtacgggatgatggtgtcggcgcgcgggcaggagatcggccgggtgtcgttg
gccgacgcgacccgcaggctcaaactggtgccgcagagccgctacgacgacgccgcggag
ttcttcggctga

DBGET integrated database retrieval system