KEGG   Mycobacterium sp. MCS: Mmcs_2071Help
Entry
Mmcs_2071         CDS       T00367                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmcs_2071
Enzymes [BR:mmc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mmcs_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2220744..2222612
Genome map
AA seq 622 aa AA seqDB search
MTAPATPTYPFSAIVGHDRLLLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAQILSRV
DGGALVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLV
DVLLDAAAMGRVHIERDGISHTHESRFVLIGTMNPEEGELRPQLLDRFGLTVDVAASRDV
DVRVEVIRARMAFEADPTGFADRHADLDAALARRVAEARALVPSVMLPDNELRRIAALCA
AFDVDGMRADLVVARTAVAHAAWRGELTVGEEDIRVAAELALPHRRRRDPFDDPGLDPQR
LDEAMEQAGESAETPDGDPDPEPPPDPPGGGVSGESPEPSRPQGNSSSAQTRSSGDPAAV
FKTRTLVVPGVGEGAPGRRSRARNRTGTVVAATADAGTGHGLHVFGTLLAAAENQRVPGR
PRPGVQDVRRSVREGQEGNLVVFVVDASGSMAARDRMAAVGGATLSLLRDAYQRRDKVAV
ITFRGREATLLLPPTTSVYIASRRLSRFDTGGKTPLAEGLLAARDVVVREKARDRARRCL
VVVLTDGRATGGPDPLGRTREAAARLVAEGAAAVVVDCETSFVRLGLAEELATALRAPAV
RLAHLRADDLTRLVTRTDRTAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcccgccacgccgacctatccgttcagcgccatcgtcggtcacgaccggtta
ctgctggcccttctgctgtgtgcggtgcggcccgagatcggcggcgtgctgatccgcggc
gagaagggcaccgcgaaatcgaccgccgtacgtgggctcgcgcagatcctgtcccgcgtc
gacggcggtgcgctcgtcgaactgccgatcggggccaccgaggaccgcgtcgtcggatcg
ctggacctgcagaaggtgcttcgcgacggtgagcacgccttctcaccgggcctgctcgcc
cgcgcccacggcggcgtgctgtacgtcgacgaggtcaacctgttgcacgaccacctggtc
gacgtgctcctcgatgcggccgcgatgggccgtgtgcacatcgaacgggacggcatctcg
cacacccacgagtctcgattcgtgctgatcggcacgatgaatcccgaagagggcgaactg
cgtccgcagctgctcgaccggttcgggctgaccgtcgacgtcgcggcgtcgcgtgacgtc
gatgtccgagtcgaggtgatccgcgcgcggatggcgttcgaggccgacccgaccggcttc
gccgaccggcacgccgacctggatgccgcactggcgcggcgggtcgccgaagcgcgcgcc
ctggtgccgtcggttatgttgccggacaacgagttacgacggattgcggcgttgtgcgcc
gcgttcgacgtggacgggatgcgggccgatctggtggtcgcgcgcaccgcggtggcgcac
gccgcgtggcggggggagctcaccgtcggcgaggaggacatccgggtggccgccgaactg
gcgctgccgcaccggcgcaggcgcgacccgttcgacgaccccggactggacccgcagcgc
ctcgacgaggcgatggagcaggccggtgagtccgccgagactcccgacggggaccccgac
cccgaaccaccgccggacccgccgggcgggggagtgtcgggcgaatcgccggaaccgtca
cggccacagggtaattcgtcgtcggcgcagactcgcagcagcggcgacccggccgcggtg
ttcaagaccaggacgctggtggtccccggtgtcggagagggggcacccggccgtcggtcg
cgcgcgcgcaatcgcaccggcaccgtcgtggcggccaccgccgacgccgggaccggccac
ggtttgcacgtcttcggcacgctgctggccgccgcggagaaccagcgggtcccgggccgg
ccccggccgggcgtgcaggacgtgcgccggtccgtgcgcgagggccaagaggggaacctg
gtggtcttcgtcgtcgacgcctcgggttcgatggcggcccgcgaccggatggccgcggtc
ggcggcgccacgctgtcgctgctgcgcgacgcctatcagcgccgggacaaggtcgcggtg
atcacgttccgcgggcgggaggccacgctgctgctgccacccacgacgtcggtgtacatc
gccagccgccggctgtcgcggttcgacaccggcggcaagacgccgctggccgaaggtctg
ctcgccgcccgcgacgtcgtcgtccgggagaaggcccgcgaccgcgcgcgccgctgtctg
gtcgtcgtgctgaccgacgggcgcgccaccgggggaccggatccgctcggccgcacccgc
gaggccgccgcccgcctggtggccgaaggggccgccgccgtggtcgtcgactgcgagacg
tcgttcgtgcggctgggtctggccgaggaactcgccacggcgctgcgcgcgcccgccgtc
cgcctggcgcacctgcgggccgacgatctcacccggctggtcacccggaccgaccgcacc
gccgcctaa

DBGET integrated database retrieval system