KEGG   Mycobacterium sp. MCS: Mmcs_2113Help
Entry
Mmcs_2113         CDS       T00367                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mmc  Mycobacterium sp. MCS
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mmc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2260754..2261257
Genome map
AA seq 167 aa AA seqDB search
MQDRESMMTVGLIWAQSTSGVIGRDGGIPWHLPEDLARFKEITLGHPVVMGRLTWESLPP
KVRPLPGRKNVVLTRQADYMAEGAEVVTSLDDALGDEETWVIGGERVYTLALGRATRCEV
TEVEIELHRQDADAVAPVLGEAWVGTAGDWLTSVSGLRYRFHSYQRA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggaccgagagtcgatgatgacggtcggactcatctgggcgcagtcgacctcgggc
gtgatcggacgcgacggtgggatcccgtggcatctgcccgaagacctggcccggttcaag
gagatcaccctcggtcaccccgtcgtgatgggccggctcacctgggagtcactgccaccg
aaggtccggccgctgccgggacggaaaaatgtcgtactcacccggcaagctgactacatg
gctgagggagctgaggtcgtgacgagcctcgacgacgcgttgggtgacgaggagacgtgg
gtgatcggcggtgagcgcgtctacacgctggcgctcggccgggccacgcgatgcgaggtc
accgaggtcgagatcgaactccaccggcaggacgccgacgccgtcgcacccgtcctcggg
gaggcctgggtcggtaccgcgggggactggctgaccagcgtctccggcttgcgctaccgg
ttccacagctaccagcgcgcatga

DBGET integrated database retrieval system