KEGG   Mycobacterium sp. MCS: Mmcs_2186Help
Entry
Mmcs_2186         CDS       T00367                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00010  Glycolysis / Gluconeogenesis
mmc00520  Amino sugar and nucleotide sugar metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
Module
mmc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_2186
   00520 Amino sugar and nucleotide sugar metabolism
    Mmcs_2186
Enzymes [BR:mmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mmcs_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABG08294
JGI: Mmcs2186
Position
complement(2326616..2327425)
Genome map
AA seq 269 aa AA seqDB search
MTATDSPVADPDAAGGDARRGFGIDVGGSGVKGGVVDLDTGQLIGERFKLPTPQPATPDA
VAKTIAAVVKEFGWTGKLGVTYPGVVTHGVVHTAANVDKSWLGVNAQEIYSAALDGQPVT
VLNDADAAGLAEERFGAGRDNTGVIVLLTFGTGIGSAVIHNGILLPNTEFGHLEVGGKEA
EHRAASSVKERKDWSYERWTQEVTKVLVAIENAIWPDLFIAGGGISRKADKWVPLLKNRT
PVVAAALQNSAGIVGAAMAAEVDVTATNR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgattcgcccgtcgcagatccggacgccgccggtggggacgcgcgtcgc
ggattcggtatcgacgtcggcggcagcggcgtcaagggcggcgtcgtcgacctggacacc
ggtcaactgatcggcgagcggttcaaactccccaccccgcagcccgccacccccgacgcc
gtcgccaagaccatcgccgcggtggtcaaggagttcggctggaccggaaagctcggcgtc
acctatcccggcgtggtgacccacggggtcgtgcacaccgccgcgaacgtcgacaagtcg
tggctgggcgtcaacgcccaggagatctacagcgccgccctcgacggtcagccggtcacg
gtgctcaacgacgccgacgcggcggggctggccgaggagcgtttcggcgcgggccgcgac
aacaccggcgtcatcgtgttgctgaccttcggcaccggtatcggctcggcggtcatccac
aacggcatcctgctgcccaacaccgaattcggtcatctggaggtgggcggcaaggaagct
gagcaccgcgccgcgtcgtcggtcaaggagcgcaaggactggagttacgagcgctggacc
caggaggtcaccaaggtcctcgtggcgatcgagaacgcgatctggcccgacctgttcatc
gccggaggcggtatcagccgcaaggccgacaagtgggtgccgctgctgaagaaccgcacg
ccggtcgtggccgccgcgctgcagaactccgccggaatcgtcggcgcggcgatggccgct
gaggtggacgtcacagctaccaaccggtaa

DBGET integrated database retrieval system