KEGG   Mycobacterium sp. MCS: Mmcs_2363Help
Entry
Mmcs_2363         CDS       T00367                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mmcs_2363 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmcs_2363 (pyrB)
Enzymes [BR:mmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mmcs_2363 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2507218..2508168
Genome map
AA seq 316 aa AA seqDB search
MTRHLLTAADLSRDEATAILDDADRFSQALIGREVKKLPTLRGRTVITMFYENSTRTRVS
FEVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAGADALIIRHPASGAAQQLAEWT
AAEAGAPSVINAGDGTHEHPTQALLDALTLRQRLGGIEGRRVVIVGDVLHSRVARSNVLL
LHTLGAEVVLVAPPTLLPVGVRQWPVTVSHDLDAELPAADAVLMLRVQAERMNGGFFPSA
REYSVRYGLSDKRQALLPDSAVVLHPGPMLRGMEISSSVADSSQSAVLQQVSNGVHVRMA
VLFHLLVGAEQEAISA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagacatctgttgaccgcggccgacctgagccgcgacgaggccaccgcgatcctc
gacgacgccgaccggttcagccaggcgctgatcggccgcgaggtcaagaagctgccgacg
ctgcgcgggcgcacggtgatcacgatgttctacgagaacagcacccgcacccgggtctcg
ttcgaggtcgcgggcaagtggatgagtgccgacgtgatcaacgtcagcgcatccggttcc
tcggtggccaagggggagtcgttgcgcgacaccgcgctcacgttgcgcgccgcgggcgcc
gacgcgctgatcatccggcatcccgcctccggcgccgcccagcaactcgcggagtggacg
gccgccgaggcgggcgcccccagcgtgatcaacgccggcgacggcacccacgaacacccc
acccaggcgttgctcgacgctctgaccctgcgccagcggctcggcggcatcgagggcagg
cgggtggtgatcgtcggcgacgtactgcacagccgcgtggcccgatccaacgtgctgctc
ctgcacaccctgggcgcggaggtggtgctggtggcgccgccgaccctgctcccggtgggt
gtgcgccagtggccggtgaccgtgtcgcacgacctggacgccgaactgcccgccgccgac
gcggtgctcatgctgcgggtgcaggccgagcggatgaacggcgggttcttcccgtccgcg
cgcgagtactcggtgcgctacggcctgtccgacaagcgtcaggcactgctgcccgattcc
gcggtggtgctgcacccggggccgatgctgcgcggtatggagatctcctcgtcggtggcc
gactcgtcgcaatcggctgtgctgcaacaggtttccaatggtgtgcacgtccggatggcg
gtgctcttccatctgctcgtcggcgcggaacaggaggcgatcagcgcatga

DBGET integrated database retrieval system