KEGG   Mycobacterium sp. MCS: Mmcs_2363Help
Entry
Mmcs_2363         CDS       T00367                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00240  Pyrimidine metabolism
mmc00250  Alanine, aspartate and glutamate metabolism
mmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mmcs_2363
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmcs_2363
Enzymes [BR:mmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mmcs_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Keratin
Motif
Other DBs
NCBI-ProteinID: ABG08471
JGI: Mmcs2363
UniProt: Q1B9G3
Position
2507218..2508168
Genome map
AA seq 316 aa AA seqDB search
MTRHLLTAADLSRDEATAILDDADRFSQALIGREVKKLPTLRGRTVITMFYENSTRTRVS
FEVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAGADALIIRHPASGAAQQLAEWT
AAEAGAPSVINAGDGTHEHPTQALLDALTLRQRLGGIEGRRVVIVGDVLHSRVARSNVLL
LHTLGAEVVLVAPPTLLPVGVRQWPVTVSHDLDAELPAADAVLMLRVQAERMNGGFFPSA
REYSVRYGLSDKRQALLPDSAVVLHPGPMLRGMEISSSVADSSQSAVLQQVSNGVHVRMA
VLFHLLVGAEQEAISA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagacatctgttgaccgcggccgacctgagccgcgacgaggccaccgcgatcctc
gacgacgccgaccggttcagccaggcgctgatcggccgcgaggtcaagaagctgccgacg
ctgcgcgggcgcacggtgatcacgatgttctacgagaacagcacccgcacccgggtctcg
ttcgaggtcgcgggcaagtggatgagtgccgacgtgatcaacgtcagcgcatccggttcc
tcggtggccaagggggagtcgttgcgcgacaccgcgctcacgttgcgcgccgcgggcgcc
gacgcgctgatcatccggcatcccgcctccggcgccgcccagcaactcgcggagtggacg
gccgccgaggcgggcgcccccagcgtgatcaacgccggcgacggcacccacgaacacccc
acccaggcgttgctcgacgctctgaccctgcgccagcggctcggcggcatcgagggcagg
cgggtggtgatcgtcggcgacgtactgcacagccgcgtggcccgatccaacgtgctgctc
ctgcacaccctgggcgcggaggtggtgctggtggcgccgccgaccctgctcccggtgggt
gtgcgccagtggccggtgaccgtgtcgcacgacctggacgccgaactgcccgccgccgac
gcggtgctcatgctgcgggtgcaggccgagcggatgaacggcgggttcttcccgtccgcg
cgcgagtactcggtgcgctacggcctgtccgacaagcgtcaggcactgctgcccgattcc
gcggtggtgctgcacccggggccgatgctgcgcggtatggagatctcctcgtcggtggcc
gactcgtcgcaatcggctgtgctgcaacaggtttccaatggtgtgcacgtccggatggcg
gtgctcttccatctgctcgtcggcgcggaacaggaggcgatcagcgcatga

DBGET integrated database retrieval system