KEGG   Mycobacterium sp. MCS: Mmcs_2370Help
Entry
Mmcs_2370         CDS       T00367                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00230  Purine metabolism
mmc01100  Metabolic pathways
Module
mmc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mmcs_2370
Enzymes [BR:mmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mmcs_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 CPT AAA_33 RsgA_GTPase MMR_HSR1 AAA_29 Cytidylate_kin AAA_22 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABG08478
JGI: Mmcs2370
UniProt: Q1B9F6
Position
2516065..2516661
Genome map
AA seq 198 aa AA seqDB search
MNTGRGVGRVVVLSGPSAVGKSTVVRCLRERIPDLYFSVSATTRAPRPGEVDGVDYSFVT
PEAFQQLIDDGALLEWAEIHGGLHRSGTPARPVREATVAGRPVLIEVDLAGARAVKQAMP
EALSVFLAPPSWEVLERRLVGRGTETPDVMSRRLDTARTELAAQSDFDVVVVNSQLESAC
SELVSLLVGHTSAGTNPA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaccggccgaggggtcggacgggtcgttgtcctgtccggcccctccgctgtcggg
aagtccaccgtggtgcggtgcctgcgcgagcgcattcccgacctgtacttcagcgtctca
gccaccacgcgggccccgcgtccgggcgaggtggacggggtcgactactccttcgtcacc
cccgaggcgtttcagcagctcatcgacgacggcgccctgttggagtgggccgagatccac
ggcggcctgcaccgctccggcaccccggcacggccggtccgcgaggccaccgtggcgggt
cggccggtgctgatcgaggtcgatctggccggcgccagggcggtcaaacaagccatgccc
gaggccctctcggtgttcctcgccccgccgagctgggaggtgctggaacgccggttggtg
ggtcgcggcaccgaaacgccggacgtgatgagccgacggctggacactgcgcgcaccgag
ttggccgcgcagagcgacttcgatgtggtcgtcgtgaacagccagttggaatctgcctgc
tcagaattggtatccttgctggtgggccacacgtcggccggcacgaatccggcctga

DBGET integrated database retrieval system