KEGG   Mycobacterium sp. MCS: Mmcs_2406Help
Entry
Mmcs_2406         CDS       T00367                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_2406 (tpiA)
   01230 Biosynthesis of amino acids
    Mmcs_2406 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_2406 (tpiA)
   00051 Fructose and mannose metabolism
    Mmcs_2406 (tpiA)
   00562 Inositol phosphate metabolism
    Mmcs_2406 (tpiA)
Enzymes [BR:mmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmcs_2406 (tpiA)
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmcs_2406 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mmcs_2406 (tpiA)
  Exosomal proteins of melanoma cells
   Mmcs_2406 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2553864..2554649
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLSYGAQDVSQHDSGAYTGEISGAFLAKLGCSFAVVGHSERRTYHHEDDALVAAKAAA
AFRHGITPIVCIGEHLKVREAGNHVEHNVEQLRGSLAGLTSEQIGQAVIAYEPVWAIGTG
RVAGAADAQEVCKAIRDELGKLSSPQLAAGIRVLYGGSVNAKNVGEIVAQEDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaagccgctgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcagaagatcgccttctcgctgccggacaagtacttcgacaaggtcgac
gtgacggtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtcgacggggac
aaactgcgcctgagctacggcgcgcaggacgtttcgcagcacgattccggtgcctacacc
ggcgagatcagcggcgcgttcctggccaagctgggctgttcgttcgccgtcgtggggcac
tcggagcgccgcacctaccaccacgaggacgacgcgctggtggccgccaaggccgccgcg
gcgttccggcacggcatcaccccgatcgtctgcatcggtgagcacctgaaggtgcgtgag
gcgggcaaccacgtcgagcacaacgtcgagcagttgcgtggttcgctggcggggctgacg
tccgagcagatcggtcaggccgtcatcgcctacgaacccgtgtgggcgatcggcaccggc
cgggtggccggcgccgccgacgcgcaggaggtgtgcaaggccatccgcgacgagctcggg
aagctctcctcaccgcagctggcggccgggatcagggtgctctacggcgggtcggtgaac
gccaagaacgtcggggagatcgtggcccaggaagacgtcgacggtgcgctggtcggtggg
gcctccctggacggtgagcagttcgccacgctgtcggcgatcgccgccggcgggcccctg
ccctga

DBGET integrated database retrieval system