KEGG   Mycobacterium sp. MCS: Mmcs_2406Help
Entry
Mmcs_2406         CDS       T00367                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_2406 (tpiA)
   01230 Biosynthesis of amino acids
    Mmcs_2406 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_2406 (tpiA)
   00051 Fructose and mannose metabolism
    Mmcs_2406 (tpiA)
   00562 Inositol phosphate metabolism
    Mmcs_2406 (tpiA)
Enzymes [BR:mmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmcs_2406 (tpiA)
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmcs_2406 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mmcs_2406 (tpiA)
  Exosomal proteins of melanoma cells
   Mmcs_2406 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2553864..2554649
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLSYGAQDVSQHDSGAYTGEISGAFLAKLGCSFAVVGHSERRTYHHEDDALVAAKAAA
AFRHGITPIVCIGEHLKVREAGNHVEHNVEQLRGSLAGLTSEQIGQAVIAYEPVWAIGTG
RVAGAADAQEVCKAIRDELGKLSSPQLAAGIRVLYGGSVNAKNVGEIVAQEDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaagccgctgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcagaagatcgccttctcgctgccggacaagtacttcgacaaggtcgac
gtgacggtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtcgacggggac
aaactgcgcctgagctacggcgcgcaggacgtttcgcagcacgattccggtgcctacacc
ggcgagatcagcggcgcgttcctggccaagctgggctgttcgttcgccgtcgtggggcac
tcggagcgccgcacctaccaccacgaggacgacgcgctggtggccgccaaggccgccgcg
gcgttccggcacggcatcaccccgatcgtctgcatcggtgagcacctgaaggtgcgtgag
gcgggcaaccacgtcgagcacaacgtcgagcagttgcgtggttcgctggcggggctgacg
tccgagcagatcggtcaggccgtcatcgcctacgaacccgtgtgggcgatcggcaccggc
cgggtggccggcgccgccgacgcgcaggaggtgtgcaaggccatccgcgacgagctcggg
aagctctcctcaccgcagctggcggccgggatcagggtgctctacggcgggtcggtgaac
gccaagaacgtcggggagatcgtggcccaggaagacgtcgacggtgcgctggtcggtggg
gcctccctggacggtgagcagttcgccacgctgtcggcgatcgccgccggcgggcccctg
ccctga

DBGET integrated database retrieval system