KEGG   Mycobacterium sp. MCS: Mmcs_2591Help
Entry
Mmcs_2591         CDS       T00367                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like protein (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmcs_2591
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmcs_2591
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmcs_2591
Enzymes [BR:mmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmcs_2591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
2748387..2749688
Genome map
AA seq 433 aa AA seqDB search
MTEQLDATHPDLVTVEVPTHWYNLAAELGEPIPPHLHPGTKEPVGPDDLAPLFASGLIAQ
EVATEIYIEIPQEVREIYTMWRPSPLIRARRFEKALNTSAHIYVKYEGVSPVGSHKTNSA
VAQAYYNSIDGVRKLTTETGAGQWGSALSFAGAQFGLEVEVWQVRASYESKPYRGHLMRT
YGGTVHSSPSTLTEAGRAILAKDPNTTGSLGMAVSEAVEVAAADPEARYALGSVLNHVVL
HQTVIGQEAVAQLALVEPNGADVVFGCAGGGSNLAGLSFPFLREKVHGRSNPRIVAAEPT
ACPSITEGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VEGVAISQRDAFAAGVQFARTQGIVPAPESTHAIAAAAAHVADDPREQVVVIGLSGHGQL
DLPAYAEYLDGKL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagctcgacgccacccatccggacctcgtcaccgtcgaggtgccgacgcac
tggtacaacctggcggccgagctgggcgagccgatcccgccgcatctgcatcccggcacc
aaagaaccggtcggcccggatgacctcgcgccgctgttcgccagcgggttgatcgcgcag
gaggtggccaccgagatttacatcgagatcccgcaggaggtgcgggagatctacacgatg
tggcgtccgtccccgctgatccgcgcccggcgcttcgagaaggccctgaacaccagcgcc
cacatctacgtcaagtacgaaggtgtcagcccggtcggcagccacaagaccaactccgcg
gtggcacaggcgtactacaactccatcgacggcgtgcggaagctcaccaccgagaccggc
gccgggcagtggggaagtgccctgtcgttcgccggagcccagttcggactggaggtcgag
gtgtggcaggtccgcgcttcgtacgagtccaagccgtatcgggggcatctgatgcggacc
tacggcggcacggtgcactcgagcccgtcgacgctcaccgaggcgggccgcgccatcctg
gccaaggatccgaacaccaccggcagcctcggcatggcggtcagcgaggcggtcgaggtt
gccgcggccgacccggaggcccgctatgcgctgggcagcgtgctcaatcatgtggtgctg
catcagaccgtcatcggccaggaggccgtcgcgcagctggcgttggtggagccgaacggc
gccgacgtcgtattcggttgcgccggaggcggttcgaacctcgccgggctgtcgtttccg
ttcctgcgggagaaggtccacggccggtcgaacccgcggatcgtggccgcagagccaact
gcgtgcccgtcgatcaccgagggtgagtaccgctacgaccatggcgacgtggccgggctc
accccgctgctcaagatgcacacgctgggtatggatttcgtgcccgacccgatccacgcc
ggcggactgcgctaccacggcatggcgccggcgctgagccacaccgtggagctgggtctg
gtcgagggcgtggcgatctcgcagcgcgacgcgttcgctgccggggtgcagttcgcgcga
acgcagggcatcgtgccggctccggagtcgacgcacgccatcgcggccgcggccgcacat
gtcgccgatgacccgcgcgagcaggtcgtggtgatcggactgtccgggcatggtcagctg
gatctgccggcctacgcggagtacctcgacggcaagctctga

DBGET integrated database retrieval system