KEGG   Mycobacterium sp. MCS: Mmcs_2817Help
Entry
Mmcs_2817         CDS       T00367                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_2817
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmcs_2817
   00630 Glyoxylate and dicarboxylate metabolism
    Mmcs_2817
Enzymes [BR:mmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mmcs_2817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2963550..2965745
Genome map
AA seq 731 aa AA seqDB search
MTDRVTVGNLRVARALYDFITDEALAGTDLDPDSFWSGVDKVVADLTPRNQELLARRDDL
QAQIDKWHRQRAIGPHDADEYKQFLTEIGYLEPDPGDFTITTAGVDDEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVISEEDGAEKGTSYNRVRGDKVIAYAREFLDGAA
PLASGSYADATGFRIEDGQVQVELGDDQWVGLADPDQFVGYTGELGSPQWSILLRNNGLH
IEILIDPDSPVGSTDKAGVKDVVLESAVTTIMDFEDSVAAVDAEDKVLGYRNWLGLNRGD
LSEEVSKGDKTFTRVLNPDRTYTTPDGSGELTLPGRSLLFVRNVGHLMTNDAITDAEGNE
VFEGIQDALFTGLIAMHGLKESDANGPLRNSRTGSVYIVKPKMHGPAEVAYTVDLFSRVE
DVLGLPQNTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPM
IRKGAMKSQPWIKAYEDQNVDVGLATGFSGRAQIGKGMWAMTDLMADMVEQKIGQPKAGA
TTAWVPSPTAATLHAMHYHQVDVYAVHKELEGKQRASLDDLLTIPLAKELAWAPEEIREE
VDNNCQSILGYVVRWIDAGVGCSKVPDIHDIALMEDRATLRISSQLLANWLRHGVITEED
VKTSLRRMAAVVDEQNAKDPDFKPMATDPDSSIAFQAAQELILAGGTQPSGYTEPILHRR
RREYKASVAGA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcgtgacggtgggaaacctgcgcgtggcccgcgcgctctacgacttcatc
accgatgaggcgctggccggtaccgatctcgacccggacagcttctggtcgggtgtcgac
aaggtcgtcgccgacctgaccccgcgcaaccaggaactgctcgcccgccgcgacgacctg
caggcgcagatcgacaagtggcaccggcagcgggcgatcggtccgcacgacgccgacgag
tacaagcagttcctcaccgagatcggctacctcgaacccgatccgggtgacttcacgatc
accaccgcaggcgtcgacgacgaaatcaccacgaccgcaggcccgcagttggtggtgccg
gtgctcaacgcccgcttcgcgctcaacgcggccaacgcgcggtggggttcgctctatgac
gcgctgtacggcaccgacgtcatcagcgaggaggacggcgccgagaagggcaccagctac
aaccgcgtccgtggcgacaaggtgatcgcctacgcgcgcgaattcctcgacggcgcagcg
ccgttggcgtccggctcctatgccgacgccaccggtttccgaatcgaggacgggcaggtg
caggtcgagctcggagacgaccagtgggtcggtctggccgacccggaccagtttgtcggc
tacaccggtgaactcggatccccgcagtggtcgatcctgctgcgcaacaacggactgcac
atcgagatcctcatcgaccccgactcgcccgtcggctcgaccgacaaggccggcgtcaag
gacgtcgtgctcgaatccgccgtcaccaccatcatggatttcgaggattcggtcgccgcg
gtcgacgccgaggacaaggtgctgggctaccgcaactggctggggctcaaccgcggcgac
ctgagcgaagaggtcagcaagggcgacaagaccttcacccgcgtgctcaaccccgaccgc
acgtacaccaccccggacggttccggcgagctcaccctgcccggccgcagcctgctgttc
gtgcgcaacgtcggacatctgatgaccaacgacgcgatcacggacgccgagggtaacgag
gtgttcgaaggtatccaggacgccctgttcaccggtctgatcgccatgcacggtctcaag
gagagtgacgcgaacggcccgctgcgcaacagccgcacgggttcggtctacatcgtcaag
cccaagatgcacggccccgccgaggtggcctacaccgtcgacctgttcagccgcgtcgag
gacgtcctggggctgccgcagaacaccctcaaggtcggcatcatggacgaggaacgccgc
accaccctgaacctcaaggcgtgcatcaaggccgccgccgaccgggtggtgttcatcaac
accgggttcctggaccgcaccggcgacgagatccacacctcgatggaggcgggtccgatg
atccgcaagggcgcgatgaagagtcagccgtggatcaaggcctacgaggaccagaacgtc
gacgtgggtctggccaccggtttctcgggccgggcccagatcggcaagggtatgtgggcg
atgacggacctgatggccgacatggtcgaacagaagatcggtcagccgaaggccggcgcc
accaccgcatgggtgccgtcgccgaccgcggccacgctgcacgccatgcactaccaccag
gtcgacgtgtacgccgtccacaaggaactcgagggcaagcagcgcgcatcgctcgacgat
ctgctcaccatcccgctggccaaggaactggcctgggcgcccgaggagatccgcgaggag
gtcgacaacaactgccagtcgatcctgggctacgtcgtccgctggatcgacgccggtgtc
ggttgttccaaggtgcccgacatccacgacatcgcgctgatggaggatcgcgccacgctg
cggatctccagccagctgctggccaactggctgcgccacggcgtcatcaccgaagaggac
gtcaagaccagcctgcgccggatggccgcggtggtcgacgagcagaacgccaaggacccg
gacttcaagccgatggcaaccgacccggactccagcatcgccttccaggccgcgcaggaa
ctcatcctcgcgggcggcacgcagcccagcgggtacaccgagccgatcctgcaccgacgc
cgacgcgagtacaaagccagcgttgccggcgcctga

DBGET integrated database retrieval system