KEGG   Mycobacterium sp. MCS: Mmcs_2869Help
Entry
Mmcs_2869         CDS       T00367                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmcs_2869
Enzymes [BR:mmc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mmcs_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3035859..3038018
Genome map
AA seq 719 aa AA seqDB search
MTELSPSLVELAARHGVATRYEDWSGTQVAVPESTLIAVLAALGVAAADDEQRAAALIQH
DRNYWQRSLPPTILARTGSTSSFWVHVTHGDPVEVWVALEDGSIRQSLHQLRNDTPPFDL
DGRLVGEASFELPADLPLGYHRVHMRTGTVEADAPLIVSPATLPVPPRLGARRSWGLATQ
LYSVRSHRSWGVGDLTDLTDLAVWSATRHGAGFILVNPLHAAAPAAPMEPSPYLPTSRRF
VNPLYLRPEAIPEYAELRHRGRLRRSRTEVQARARRRELIDRDSAWRAKRAALATIYRVE
RSAGRELAYAGYRAREGRALDDFAVWCALAEKYGNDWHGWPAELQHPRNVAVAAFAAEHA
DEVDFHRWLQWQLDEQLTAAHATAIGAGMDIGVMHDLAVGVNPDGADAWALQEVLALGVT
AGAPPDEFNQLGQDWSQPPWRPDQLVEQAYEPFRALVNGVLRHAGGVRIDHIIGLFRLWW
IPRGAAPTEGTYVRYDHEAMIGIVALEAHRTGAVVVGEDLGTVEPWVRDYLHDRGLFGTS
ILWFEQDRDGQDATGGPLPAERWREYCLSAVTTHDLPPTAGYLAGEHVRLRDELGLLTRP
AAEELADDRAAQAAWLAELRRVGLLAHPDNGEEPESDAVILALHRYLGRTPSKLLSLSLA
DAVGDLKTQNQPGTSDEYPNWRVPLRGPDGRQRLVEDVFTDPRAAALGAVMGSLVHPVL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgtccccgtcactggtcgaactcgccgcccgccacggcgtcgccacccgc
tacgaggactggtccggcacccaggtcgccgtgcccgagtcgacgctgatcgcggtgctc
gccgcactgggcgtcgccgcagcggacgacgagcaacgcgccgccgcgctcatacagcac
gaccgcaattactggcagcggtcactgccgcccacgatcctggcccgcaccggaagcacg
tcgtcgttctgggtgcacgtcacccacggtgacccggtcgaggtctgggtggccctggaa
gacgggtcgatccgccagagcctgcaccaattacgcaacgacacaccgcctttcgacctc
gacggccgactggtcggggaggccagcttcgagctgcccgccgatctgccgctgggttac
caccgggtgcacatgcggaccggaacggtcgaggccgatgcaccgctgatcgtctccccc
gccacgctgcccgtgccgccgcggctcggggcccggcgcagctgggggttggcgacccag
ctctacagcgttcgctcccaccgctcctggggtgtcggcgacctgacggatctgacggac
ctggcggtgtggtcggcgacgcggcacggcgccgggttcatcctggtcaaccccctgcac
gcggccgcgcctgccgcgccgatggagccgtcgccgtacctgcccacctcgcgacggttc
gtcaacccgctgtacctacggccggaggcgatccccgagtacgccgaactccgccatcgg
ggtcggttgcgcaggtcgcggaccgaggttcaggcccgtgcccggcgcagggagctcatc
gatcgcgattccgcctggcgggccaaacgggcggccctggcgaccatctaccgtgtcgaa
cgttcggccggccgtgagctcgcctacgccgggtaccgggcgcgggagggccgcgcgctc
gacgatttcgccgtgtggtgcgcgttggccgagaagtacggcaacgactggcacggctgg
cccgccgaactgcagcatccccgcaacgtggcggtggccgcgttcgccgccgagcacgcc
gacgaggtggacttccaccggtggctgcagtggcagctcgacgagcagctcaccgccgcg
cacgccacggcgatcggcgcggggatggacatcggggtcatgcacgacctcgcggtcggg
gtgaatcccgacggggccgacgcgtgggcactgcaggaggtcctggccctcggcgtcacc
gcgggcgcgccgcccgacgagttcaaccagctcggccaggactggtcgcagccgccgtgg
cgacccgaccagctcgtcgagcaggcctacgaaccgttccgggcgttggtcaacggggtg
ctgcggcacgcgggcggtgtccggatcgaccacatcatcggactgttccggctgtggtgg
atcccccggggcgccgcaccgaccgagggcacctatgtccgctacgaccacgaggcgatg
atcggcatcgtcgcgctcgaggcgcaccgtacgggggcggtcgtggtcggtgaggatctc
ggcaccgtcgaaccctgggtgcgcgactacctgcacgaccgcggactgttcggcacctcg
atcctgtggttcgaacaggaccgcgacggccaggacgccacaggtggtccgctccccgcc
gagcggtggcgggagtactgcctctcggcggtgaccacccatgatctgccgccgacggcc
ggttacctcgccggtgaacacgtccggttgcgcgacgaactcggactgcttacccgcccg
gcggccgaggaactcgccgacgaccgggcggcgcaggccgcgtggctggccgaactgcgc
cgggtcggcctgttggcccacccggacaacggcgaggaaccggagtccgatgccgtgatc
ctcgccctgcaccggtatctgggccggaccccgtcgaagctgctgtcgctgtccctggcc
gacgccgtcggcgatctgaagacccagaaccagccgggaacgagtgacgagtaccccaac
tggcgggtgccgctgcggggtccggacgggcgccagcgcctggtcgaggacgtgttcacc
gacccgcgggccgcggcgctcggcgccgtgatgggttcgttggtgcacccggtcctgtga

DBGET integrated database retrieval system