KEGG   Mycobacterium sp. MCS: Mmcs_3049Help
Entry
Mmcs_3049         CDS       T00367                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmcs_3049
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmcs_3049
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmcs_3049
Enzymes [BR:mmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmcs_3049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3226760..3227548)
Genome map
AA seq 262 aa AA seqDB search
MSRLGGLFDACRAERRAALIGYLPTGFPDVPASISAMTALVESGCDIIEVGIPYSDPGMD
GPVIAAATEAALQGGVRVRDTLTAVEAISNAGGRAVVMTYWNPVLRWGIDAFARDLAAAG
GLGLITPDLIPEEADEWMAASDAHDLDRIFLVAPASTPERLAKTVQATRGFVYAASTMGV
TGARDAVSSAAPELVARVKEVSDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKD
GVPAVRALTEELAEGVRQRVTA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggttgggtggcttgttcgacgcttgccgagcggagcgacgcgcggcgctcatc
ggatacctgccaaccggattccccgacgtgccggcatcgatctcggcgatgacagcgttg
gtcgaatcgggttgcgacatcatcgaagtcggcatcccgtactccgacccggggatggac
ggcccggtcatcgccgccgccaccgaggcggcgctgcagggcggcgttcgggtgcgcgac
accctgacggcggtcgaggccatcagcaacgccggcgggcgcgcagtggtgatgacgtac
tggaatcccgtgctgcggtgggggatcgacgccttcgcgagggatctcgccgccgcgggt
ggactgggtctgatcacccctgatctcattcccgaagaggcagacgagtggatggcggct
tccgacgcccacgatctggaccggatcttcctggtggccccggcgtcgacgcccgagcgg
ctggccaagacggtccaggcgacacgggggttcgtctacgcggcgtcgacgatgggcgtc
accggtgcccgggacgccgtctcgagtgccgctcccgaactcgtcgcgcgcgtcaaggag
gtctccgacatcccggtcggcgtcggcctcggtgtgcggtcgcgggagcaggccgccgag
atcggcgcgtacgccgacggcgtgatcgtcggatcggcgctggtgtcggcgctcaaggac
ggtgtgcccgcggtgcgcgcgctgaccgaggaactagctgagggagtccgccagagggtg
accgcgtga

DBGET integrated database retrieval system