KEGG   Mycobacterium sp. MCS: Mmcs_3050Help
Entry
Mmcs_3050         CDS       T00367                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmcs_3050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmcs_3050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmcs_3050
Enzymes [BR:mmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmcs_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3227545..3228807)
Genome map
AA seq 420 aa AA seqDB search
MAELVDSDLPRSSAAVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVTAAYEKARGDQ
TFLDELDRLQRHYSGRPSPLYEATRLSEHAGGTRIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLDCVIYMGAVDTARQALNVARMRLLGAEVVS
VEAGSKTLKDAINEAFRDWVTNADETYYCFGTAAGPHPFPLMVRDFQRIIGLEARVQIQA
QAGRLPDAVTACVGGGSNAIGVFHAFIDDPRVRLIGYEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRAEYRPITDTEAMDAFSL
LCRTEGIIPAIESAHAVAGALKLGPELGPGSVILVNLSGRGDKDVETAAKWFGLLDKGGS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaactcgtcgactcggacctgccgcgctccagtgcggccgtcgccgaacccacc
agccacgacccggacgcccgcggccacttcggcccgtacggcggacgcctcgttcccgag
gcgctgatggcggtcatcgaggaggtcaccgcggcctacgagaaggcccgtggcgatcag
acgttcctcgacgaactcgatcggctgcagcgccactacagcggccgtccttcgccgctg
tacgaggccacccggctcagcgagcacgccggcgggacgcgcatcttcctcaaacgagaa
gacctcaaccacacgggttcccacaagatcaacaatgtgctcgggcaggcgctgctcgca
cgtcagatgggcaagacccgggtcatcgccgagaccggcgccggccagcacggtgtcgcg
acggccaccgcctgcgcactgctcggcctggactgcgtgatctacatgggcgcggtcgac
acggcccgtcaggcgctgaatgtggcgcgcatgcgcctgctcggcgccgaggtggtctcc
gtggaggccggttcgaagacgctcaaggacgcgatcaacgaggcctttcgcgactgggtc
accaacgccgacgagacgtactactgcttcggcaccgcggcgggcccgcacccgttcccg
ttgatggtgcgcgatttccagcgcatcatcggcctcgaagcgcgggtgcagatccaggcc
caggccggccggctcccggatgcggtgacggcgtgcgtcggcggcggctccaatgcgatc
ggcgtcttccacgccttcatcgacgatccccgtgtgcggttgatcggttacgaggcggcc
ggagacggggtcgaaacgggccggcacgccgccacgttcaccggcggctcacccggtgcg
ttccagggctccttctcctacctgctgcaggacgaggacggccagacgatcgaatcgcat
tcgatctcggccggtctggactatccaggcgtggggcccgagcacgcgctgctcaaggac
atcggtcgcgccgagtaccggcccatcaccgataccgaggccatggacgcgttctcgctg
ctgtgccgcaccgaggggatcatcccggccatcgagtccgcgcacgcggtcgccggtgcg
ctcaagctcggcccggaactcgggccgggttcggtgatcctggtcaacctgtccgggcgc
ggtgacaaggacgtcgagaccgcagcgaaatggttcggtctgctggacaaaggcggttca
tga

DBGET integrated database retrieval system