KEGG   Mycobacterium sp. MCS: Mmcs_3063Help
Entry
Mmcs_3063         CDS       T00367                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mmc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3238491..3239915)
Genome map
AA seq 474 aa AA seqDB search
MNVSPVTMARIDLRGRTLSTAQLRSALPRGGVDVDAVVPKVRPIVEAVAERGAEAALEYG
EAFDGVRPASVRVPAERLASALAELDPDVRAALQVAIDRARAVHADQRRTDTTTTLAPGA
TVTERWVPLERVGLYVPGGNAVYPSSVVMNVVPAQTAGVDSLVIASPPQADHGGLPHPTI
LAAAALLGVDEVWAVGGAQAVALLAYGGTDIDGTGASGAPGDGTGASGAPGDGTGASGAP
GDGTELAPVDMITGPGNIYVTAAKRICRSQVGIDAEAGPTEIAVLADHTADPVHVAADLI
SQAEHDEMAASVLVTTSPDLADAIDRELRRQLETTVHRERVSTALTGEQSAIVLVDDLDA
GVRVVNAYAAEHLEIQTVDAAEVAGRIRSAGAIFVGPYAPVSLGDYCAGSNHVLPTAGCA
RHSSGLSVQTFLRGIHVVDYTEAALKDVSGYVITLAQAENLPAHGEAVRRRFES
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtatcgccggtgacgatggcccgcatcgacttgcgcgggaggactctgtccact
gcgcagttgcggtcggcgctgccgcgtggcggtgtcgacgtcgacgccgtcgtgccgaag
gtccgcccgatcgtcgaggccgtcgccgagcgcggcgccgaggccgcactcgaatacggc
gaggcgttcgacggggtccgtcccgcgtcggtgcgcgtgcctgccgagcggttggcgtcg
gcgctggccgaactcgatcccgacgtccgcgcggcgctgcaggtcgcgatcgaccgggcc
cgcgctgtacacgccgaccagcgacgcaccgacaccacgaccaccctggcccccggagcg
accgtcaccgaacgctgggtgccgctcgagcgggtcgggctctacgtaccgggcggcaac
gcggtctacccctcgagtgtggtgatgaacgtggtgcccgcccagaccgcgggcgtcgac
tcgctggtcatcgccagcccgccgcaggccgaccacgggggactgccacacccgaccatc
ctggcggccgccgcgctcctcggcgtcgacgaggtgtgggcggtcggcggcgcccaggcc
gtcgcgctgctggcctacggcggcaccgatatcgatggcactggggcaagcggagcgccg
ggagatggcactggggcaagcggagcgccgggagatggcactggggcaagcggagcgccg
ggagatggcaccgagctcgcgccggtggacatgatcaccggccccggcaacatctacgtc
accgccgccaagcggatctgccgctcacaggtcggcatcgacgccgaggccgggccgacc
gagatcgcggtgctggccgaccacaccgccgatccggtgcatgtcgcggccgacctgatc
agccaggccgaacacgacgagatggccgccagcgtgctggtgaccacgagccccgacctg
gccgacgccatcgaccgtgaactgcggcgccagctcgagacgacggtgcaccgcgaacgc
gtcagcacggcactgaccggtgagcagtccgcgatcgtgctcgtcgacgacctcgacgcc
ggggtgcgggtcgtgaacgcctacgccgcagaacatctcgagatccagacggtcgacgcc
gccgaggtggccggccggatccgttctgccggtgcgatcttcgtcggtccgtacgcgccg
gtcagcctcggggactactgcgccgggtcgaaccacgtgctgccgacggcggggtgcgcc
cgccactccagcggtctgtcggtgcagacgttcctgcgcggcatccacgtcgtcgactac
accgaggcggcgctcaaggacgtgtcgggatacgtgatcaccctggcgcaggccgagaac
ctgcccgcccacggcgaagcggtgcgacggaggttcgagtcatga

DBGET integrated database retrieval system