KEGG   Mycobacterium sp. MCS: Mmcs_3225Help
Entry
Mmcs_3225         CDS       T00367                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mmcs_3225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_3225
  Lipid metabolism
   00071 Fatty acid degradation
    Mmcs_3225
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mmcs_3225
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mmcs_3225
   00626 Naphthalene degradation
    Mmcs_3225
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mmcs_3225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3416518..3417618
Genome map
AA seq 366 aa AA seqDB search
MIAEAMVLTGPRSLQRRQMTIPDVGDRGAILRVEACGLCGTDHEQFTGHLPAGFSFVPGH
EIVGIVEHVGAAAGQRWGVQAGQRVAVEVFRSCRDCPECRRGEYRRCAVNGIATMFGFVD
VEVGAGLWGGYATHVELPWDAMLLPIAEDMDPVLATLFNPLGAGIQWGATLPDTKAGDVV
AILGPGIRGICAAVAAKEAGAAFVAMTGVGPRDEQRLAIARSFGVDLPIDVSQDDAVTAL
QRETGGRLADVVVDVTAKAPSAFADAVGLARPGGTIVVAGTRGGGGAPRFEPDLLVYKEL
HVVGALGVEYPAHRAALEILALGRWPFDRITRESTGFAGLAQLLTSLADESARSSGALHN
VFLPTP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgaggcgatggtgctgaccggaccgcggagtctgcagcggcgccagatgacc
atccccgacgtcggcgaccggggtgcgatcctgcgagttgaagcatgcggtctgtgcgga
acagatcacgaacaattcaccggacacctgcctgccggcttctcattcgttccagggcac
gaaatcgtcggcatcgtcgaacatgttggcgctgcggctggccaacgctggggtgtacaa
gccggccagcgcgtggccgttgaggtgttccggtcctgccgagactgccccgagtgccgc
cgcggcgaataccggcggtgcgcggtgaacggcatcgccaccatgttcgggtttgtcgac
gtggaggtcggcgcgggcttatggggcggatacgccacccatgtggagcttccgtgggac
gcgatgctgctcccgattgccgaagacatggaccccgttctcgccacgttgttcaaccct
ctcggggccggtatccagtggggggcgactcttcccgacaccaaggccggggacgtcgta
gcgatcctggggcccggcatccgcggaatctgtgcggcggtggcggccaaagaggcggga
gccgcgttcgtcgcgatgaccggcgtaggcccacgcgacgaacaacgactggccatagcc
agatcattcggtgtcgacctgcccatcgatgtatcgcaggacgatgcagtgaccgcgctc
cagcgtgagacaggcggacggcttgccgacgtggtcgtcgacgtcaccgctaaagcaccc
tccgcgttcgccgatgccgtcggccttgccaggcccggcggcacaattgtggtggccggc
acccgtggaggaggcggcgcgccccggtttgaaccagacttgttggtctataaagaatta
cacgtcgtaggcgcactcggcgtggagtatcccgcccaccgggcagccctcgagattctc
gccctgggccgctggccgttcgaccggatcaccagagaatcaaccggattcgctgggctc
gcgcagctgctcacttcgcttgcagatgaaagtgcccgatcaagtggggcgctgcacaac
gtctttttgcccacgccctaa

DBGET integrated database retrieval system