KEGG   Mycobacterium sp. MCS: Mmcs_3283Help
Entry
Mmcs_3283         CDS       T00367                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mmcs_3283
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mmcs_3283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3479269..3480300)
Genome map
AA seq 343 aa AA seqDB search
MLKLHGRIVSNVDATRIGAGRRLRSMTGHILGAVPATEVPRYAGKSTFARIADIGEVSDY
DIAILGVPFDGGTSYRPGARFGPMGVRQAARTLRPGYHVELGVAPLERVQVVDAGDVTVT
PYDIAEACRQIQNHAADILGGGSRRIVAIGGDHTIALPNLRALHAVHGPVALVHFDAHLD
TWDTYFNAPVTHGTIFRRAFEEGLLVEDHSIHVGIRGPIYDQIDLHEDAEMGFKIIRAGD
LDVIGIDAAVDTVRRRVGDAPVYLSVDIDVLDPAFAPGTGTPESGGLTARELLRMLRRLH
GLNIVGGDVVEVAPAYDHAEITCVAAATVVFDLVSLMVAGGAG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacttcatggccggattgtgtcaaacgtcgacgcgacacgcatcggtgccggc
cgcaggctgaggtccatgaccggacacatcctgggcgccgtgcccgccaccgaggtgccc
cgctacgcaggcaagagcaccttcgcccgcatcgccgacatcggggaggtcagtgactac
gacatcgcgatcctcggtgtcccgttcgacggcggcacgtcataccggcccggtgcgcgc
ttcggacccatgggggtgcgccaggctgcgcgcacgctgcgccccgggtaccacgtcgaa
ctcggggtcgcgccgctggagcgggtgcaggtcgtcgacgccggtgacgtcaccgtcacc
ccctacgacatcgccgaggcctgccgccagatccagaaccacgccgccgacatcctcggc
ggcgggtcccgccggatcgtggccatcggcggcgaccacaccatcgcgctgcccaacctg
cgcgcgctgcacgcggtgcacggcccggtggccctggtgcacttcgatgcccacctcgac
acctgggacacctacttcaacgccccggtcacgcacggcacgatcttccgtcgggcgttc
gaggaaggcctgctggtcgaggaccactccatccacgtcggtatccgaggacccatctac
gaccagatcgacctgcatgaggacgcggagatgggattcaagatcatccgggcgggcgac
ctggacgtgatcgggatcgacgccgcggtcgacaccgtgcgccgccgggtcggggacgcg
ccggtgtatctgtccgtcgacatcgacgtgctcgacccggcgttcgcccccggcaccggc
accccggaatccgggggcctcaccgccagggaactgctgcgcatgctgcggcggttgcac
gggctcaacatcgtcggtggtgatgtggtggaggtggcgcccgcctacgaccacgccgag
atcacctgtgtcgcagccgcgaccgtcgtattcgacctggtgtcgctgatggtcgccgga
ggtgcgggctaa

DBGET integrated database retrieval system