KEGG   Mycobacterium sp. MCS: Mmcs_3313Help
Entry
Mmcs_3313         CDS       T00367                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_3313
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmcs_3313
  Amino acid metabolism
   00310 Lysine degradation
    Mmcs_3313
Enzymes [BR:mmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mmcs_3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3510083..3511918
Genome map
AA seq 611 aa AA seqDB search
MAVSVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTDKVDTEIPSPASGVLQKIV
AQEDDTVEVGGELAVIGEGGEDSGDSSDDSSSDEDEDEEPAEEAESETTSEESDSSEETD
SSEETESEPEPEPEPKKESKPKPKSSGSATPVTMPELGESVTEGTVTRWLKKVGDSVEVD
EPLLEVSTDKVDTEIPSPVAGTLLEIIAEEDDTVEVGGELAKIGDADQAEAEEPEPEPEP
EPEPEPEPEPEPEPKQESKPEPKPEPKQESKQEAKPEPKKEPEPQQDAEPSDGSGPYVTP
LVRKLAAEHDVDLAAVKGTGVGGRIRKQDVLAAAEADKKAKSGPEDAAEAPGKAPAAATA
SANASDAPLAHLRGTKQKANRIRQLTAKKTRESLQATAQLTQTHEVDMTKIVALRAKAKN
DFAEREGVNLTYLPFIARAVIDALKQHPNVNASYNEDTKEITYYDAEHLGFAVDTDQGLL
SPVIKNAGDLSLAGLARAIADIAARARSGDLKPDELSGGTFTITNIGSQGALFDTPILVP
PQAAMLGTGAIVKRPRVIVDEFGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKRRL
EEGSFEADLGL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggccgtctctgttcagatgcccgcactcggtgagagcgtcaccgaaggcaccgtcacc
cggtggctcaagcaagagggtgacacggtcgaacaggacgaacccctactcgaagtgtcg
accgacaaggtcgacaccgagatcccgtccccggcctccggcgtgctgcagaagatcgtg
gcgcaggaagacgacaccgtcgaggtcggcggggaactcgccgtgatcggcgagggcggc
gaggattcgggcgactcctccgacgactcgtcttccgacgaggacgaggacgaggagcct
gcggaggaagcggagtcggagaccacctccgaggagtccgacagctccgaggagaccgac
agctccgaagagaccgagagcgagccggaacccgaaccggagccgaagaaggagtcgaag
ccgaagccgaagtcctcgggttcggcgaccccggtgacgatgcccgagctgggtgagtcc
gtcaccgagggcacggtcacccggtggctcaagaaggtcggcgacagcgtcgaggtcgac
gaaccgctgctggaggtgtcgaccgacaaggtggacaccgagatcccctcgccggtcgcg
ggcaccctgctcgagatcatcgccgaggaggacgacacggtcgaggtcggcggggaactc
gcgaagatcggcgatgccgatcaggccgaggccgaagagcccgaaccggagccggaaccc
gagccggagccggagcccgaacccgaaccggaacccgagccgaagcaggagtccaagccg
gagccgaagcccgagcccaaacaggagtccaagcaggaagccaagcccgagcccaagaag
gagcccgagccgcagcaggatgccgagccgtccgacggcagcggcccgtacgtcacgccg
ctggtgcgcaaactggccgccgagcacgacgtggacctggccgccgtcaagggcaccgga
gtcggcggacgcatccgcaagcaggacgtcctggcggcggccgaggccgacaagaaggcc
aagtccggccccgaggacgccgccgaggcacccgggaaggcgccggccgcggcgacggca
tccgcgaacgcctcggacgcaccgctggctcacctgcgcggcaccaagcagaaggccaac
cggatccgtcagctgaccgcgaagaagacgcgcgaatccctgcaggcgacagcgcagttg
acgcagacccacgaggtcgacatgaccaagatcgtggcgttgcgggccaaggcgaaaaac
gacttcgccgagcgcgagggcgtcaacctgacctatctgccattcatcgccagggcggtc
atcgacgcgctcaaacagcatccgaacgtcaacgccagctacaacgaggacaccaaggag
atcacctactacgacgccgagcacctcggcttcgcggtggacaccgatcagggtctgctc
tcgccggttatcaagaacgccggtgacctctcgctggccgggctggcccgcgcgatcgcc
gacatcgccgcgcgtgcccgctccggtgacctcaaaccggacgaactgtccggcggcacc
ttcacgatcaccaacatcggcagccagggcgccctgttcgacacgccgatcctggtgccg
ccgcaggcggcgatgctgggcaccggtgcgatcgtcaaacggccgcgggtgatcgtcgac
gagttcggcaacgagtcgatcggcgtgcggtcgatctgctacctgccgctgacctacgac
caccgactcatcgacggtgccgacgccggtcgcttcctgaccaccatcaagcgccgactc
gaagagggttcgttcgaggcagacctgggtctgtaa

DBGET integrated database retrieval system