KEGG   Mycobacterium sp. MCS: Mmcs_3313Help
Entry
Mmcs_3313         CDS       T00367                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00020  Citrate cycle (TCA cycle)
mmc00310  Lysine degradation
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
Module
mmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmcs_3313
  Amino acid metabolism
   00310 Lysine degradation
    Mmcs_3313
Enzymes [BR:mmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mmcs_3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Trypan_PARP GCV_H Biotin_lipoyl_2 TonB_N DUF2254 BUD22 SDA1 eIF-3c_N
Motif
Other DBs
NCBI-ProteinID: ABG09420
JGI: Mmcs3313
Position
3510029..3511918
Genome map
AA seq 629 aa AA seqDB search
MGVTFDPIRLSRSRESQHMAVSVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTD
KVDTEIPSPASGVLQKIVAQEDDTVEVGGELAVIGEGGEDSGDSSDDSSSDEDEDEEPAE
EAESETTSEESDSSEETDSSEETESEPEPEPEPKKESKPKPKSSGSATPVTMPELGESVT
EGTVTRWLKKVGDSVEVDEPLLEVSTDKVDTEIPSPVAGTLLEIIAEEDDTVEVGGELAK
IGDADQAEAEEPEPEPEPEPEPEPEPEPEPEPKQESKPEPKPEPKQESKQEAKPEPKKEP
EPQQDAEPSDGSGPYVTPLVRKLAAEHDVDLAAVKGTGVGGRIRKQDVLAAAEADKKAKS
GPEDAAEAPGKAPAAATASANASDAPLAHLRGTKQKANRIRQLTAKKTRESLQATAQLTQ
THEVDMTKIVALRAKAKNDFAEREGVNLTYLPFIARAVIDALKQHPNVNASYNEDTKEIT
YYDAEHLGFAVDTDQGLLSPVIKNAGDLSLAGLARAIADIAARARSGDLKPDELSGGTFT
ITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDEFGNESIGVRSICYLPLTYDHR
LIDGADAGRFLTTIKRRLEEGSFEADLGL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgacattcgacccgatacgactgagccgttcgagggagtcacaacacatggcc
gtctctgttcagatgcccgcactcggtgagagcgtcaccgaaggcaccgtcacccggtgg
ctcaagcaagagggtgacacggtcgaacaggacgaacccctactcgaagtgtcgaccgac
aaggtcgacaccgagatcccgtccccggcctccggcgtgctgcagaagatcgtggcgcag
gaagacgacaccgtcgaggtcggcggggaactcgccgtgatcggcgagggcggcgaggat
tcgggcgactcctccgacgactcgtcttccgacgaggacgaggacgaggagcctgcggag
gaagcggagtcggagaccacctccgaggagtccgacagctccgaggagaccgacagctcc
gaagagaccgagagcgagccggaacccgaaccggagccgaagaaggagtcgaagccgaag
ccgaagtcctcgggttcggcgaccccggtgacgatgcccgagctgggtgagtccgtcacc
gagggcacggtcacccggtggctcaagaaggtcggcgacagcgtcgaggtcgacgaaccg
ctgctggaggtgtcgaccgacaaggtggacaccgagatcccctcgccggtcgcgggcacc
ctgctcgagatcatcgccgaggaggacgacacggtcgaggtcggcggggaactcgcgaag
atcggcgatgccgatcaggccgaggccgaagagcccgaaccggagccggaacccgagccg
gagccggagcccgaacccgaaccggaacccgagccgaagcaggagtccaagccggagccg
aagcccgagcccaaacaggagtccaagcaggaagccaagcccgagcccaagaaggagccc
gagccgcagcaggatgccgagccgtccgacggcagcggcccgtacgtcacgccgctggtg
cgcaaactggccgccgagcacgacgtggacctggccgccgtcaagggcaccggagtcggc
ggacgcatccgcaagcaggacgtcctggcggcggccgaggccgacaagaaggccaagtcc
ggccccgaggacgccgccgaggcacccgggaaggcgccggccgcggcgacggcatccgcg
aacgcctcggacgcaccgctggctcacctgcgcggcaccaagcagaaggccaaccggatc
cgtcagctgaccgcgaagaagacgcgcgaatccctgcaggcgacagcgcagttgacgcag
acccacgaggtcgacatgaccaagatcgtggcgttgcgggccaaggcgaaaaacgacttc
gccgagcgcgagggcgtcaacctgacctatctgccattcatcgccagggcggtcatcgac
gcgctcaaacagcatccgaacgtcaacgccagctacaacgaggacaccaaggagatcacc
tactacgacgccgagcacctcggcttcgcggtggacaccgatcagggtctgctctcgccg
gttatcaagaacgccggtgacctctcgctggccgggctggcccgcgcgatcgccgacatc
gccgcgcgtgcccgctccggtgacctcaaaccggacgaactgtccggcggcaccttcacg
atcaccaacatcggcagccagggcgccctgttcgacacgccgatcctggtgccgccgcag
gcggcgatgctgggcaccggtgcgatcgtcaaacggccgcgggtgatcgtcgacgagttc
ggcaacgagtcgatcggcgtgcggtcgatctgctacctgccgctgacctacgaccaccga
ctcatcgacggtgccgacgccggtcgcttcctgaccaccatcaagcgccgactcgaagag
ggttcgttcgaggcagacctgggtctgtaa

DBGET integrated database retrieval system