KEGG   Mycobacterium sp. MCS: Mmcs_3313Help
Entry
Mmcs_3313         CDS       T00367                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_3313
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmcs_3313
  Amino acid metabolism
   00310 Lysine degradation
    Mmcs_3313
Enzymes [BR:mmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mmcs_3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3510083..3511918
Genome map
AA seq 611 aa AA seqDB search
MAVSVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTDKVDTEIPSPASGVLQKIV
AQEDDTVEVGGELAVIGEGGEDSGDSSDDSSSDEDEDEEPAEEAESETTSEESDSSEETD
SSEETESEPEPEPEPKKESKPKPKSSGSATPVTMPELGESVTEGTVTRWLKKVGDSVEVD
EPLLEVSTDKVDTEIPSPVAGTLLEIIAEEDDTVEVGGELAKIGDADQAEAEEPEPEPEP
EPEPEPEPEPEPEPKQESKPEPKPEPKQESKQEAKPEPKKEPEPQQDAEPSDGSGPYVTP
LVRKLAAEHDVDLAAVKGTGVGGRIRKQDVLAAAEADKKAKSGPEDAAEAPGKAPAAATA
SANASDAPLAHLRGTKQKANRIRQLTAKKTRESLQATAQLTQTHEVDMTKIVALRAKAKN
DFAEREGVNLTYLPFIARAVIDALKQHPNVNASYNEDTKEITYYDAEHLGFAVDTDQGLL
SPVIKNAGDLSLAGLARAIADIAARARSGDLKPDELSGGTFTITNIGSQGALFDTPILVP
PQAAMLGTGAIVKRPRVIVDEFGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKRRL
EEGSFEADLGL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggccgtctctgttcagatgcccgcactcggtgagagcgtcaccgaaggcaccgtcacc
cggtggctcaagcaagagggtgacacggtcgaacaggacgaacccctactcgaagtgtcg
accgacaaggtcgacaccgagatcccgtccccggcctccggcgtgctgcagaagatcgtg
gcgcaggaagacgacaccgtcgaggtcggcggggaactcgccgtgatcggcgagggcggc
gaggattcgggcgactcctccgacgactcgtcttccgacgaggacgaggacgaggagcct
gcggaggaagcggagtcggagaccacctccgaggagtccgacagctccgaggagaccgac
agctccgaagagaccgagagcgagccggaacccgaaccggagccgaagaaggagtcgaag
ccgaagccgaagtcctcgggttcggcgaccccggtgacgatgcccgagctgggtgagtcc
gtcaccgagggcacggtcacccggtggctcaagaaggtcggcgacagcgtcgaggtcgac
gaaccgctgctggaggtgtcgaccgacaaggtggacaccgagatcccctcgccggtcgcg
ggcaccctgctcgagatcatcgccgaggaggacgacacggtcgaggtcggcggggaactc
gcgaagatcggcgatgccgatcaggccgaggccgaagagcccgaaccggagccggaaccc
gagccggagccggagcccgaacccgaaccggaacccgagccgaagcaggagtccaagccg
gagccgaagcccgagcccaaacaggagtccaagcaggaagccaagcccgagcccaagaag
gagcccgagccgcagcaggatgccgagccgtccgacggcagcggcccgtacgtcacgccg
ctggtgcgcaaactggccgccgagcacgacgtggacctggccgccgtcaagggcaccgga
gtcggcggacgcatccgcaagcaggacgtcctggcggcggccgaggccgacaagaaggcc
aagtccggccccgaggacgccgccgaggcacccgggaaggcgccggccgcggcgacggca
tccgcgaacgcctcggacgcaccgctggctcacctgcgcggcaccaagcagaaggccaac
cggatccgtcagctgaccgcgaagaagacgcgcgaatccctgcaggcgacagcgcagttg
acgcagacccacgaggtcgacatgaccaagatcgtggcgttgcgggccaaggcgaaaaac
gacttcgccgagcgcgagggcgtcaacctgacctatctgccattcatcgccagggcggtc
atcgacgcgctcaaacagcatccgaacgtcaacgccagctacaacgaggacaccaaggag
atcacctactacgacgccgagcacctcggcttcgcggtggacaccgatcagggtctgctc
tcgccggttatcaagaacgccggtgacctctcgctggccgggctggcccgcgcgatcgcc
gacatcgccgcgcgtgcccgctccggtgacctcaaaccggacgaactgtccggcggcacc
ttcacgatcaccaacatcggcagccagggcgccctgttcgacacgccgatcctggtgccg
ccgcaggcggcgatgctgggcaccggtgcgatcgtcaaacggccgcgggtgatcgtcgac
gagttcggcaacgagtcgatcggcgtgcggtcgatctgctacctgccgctgacctacgac
caccgactcatcgacggtgccgacgccggtcgcttcctgaccaccatcaagcgccgactc
gaagagggttcgttcgaggcagacctgggtctgtaa

DBGET integrated database retrieval system